SecReT4
Protein ID: 94152707
T4SS name [ID]Trb [773]
Gene symboltrbG
Locus tagRmet_6300
StrainCupriavidus metallidurans CH34
Repliconplasmid pMOL28 [GenBank: NC_007972] [Browse all T4SS(s) in this replicon]
Location [Strand]155723..156634 [-]
Productmating pair formation protein
Component typeTrbG
UniProt IDQ5NV41
KEGG IDrme:Rmet_6300
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.3e-52, Aligned region: 71..294
Protein Sequence: 303 a.a.     [Download]
>gi|94152707|ref|YP_582109.1| mating pair formation protein [Cupriavidus metallidurans CH34]
MEARTPSRFIPLAIALCMAMLLSAPDSHAADKNARRTGAGMAGLGIGDLSDAMNPANPFNGGVDPIALPG
DSRLVVFTYSRDQIFRVLSAPLKITTIEFPDDEQIVGDPAWGENVRWDYDTDGANHLYVKPQAAGLVNTL
SVNTNKRSYEFTLVSSPLGGIFYQKVRFKVPTSISAKVKARNDARGEAPDEAKGAEAEGSRNPDAVGVSP
DQLNFEYAISGSASFKPETAFDDGKALWLRLPNAALQNWPVAFIKDGSDFVVVNAIRRGGYLVVQRLADT
VVLRSGDDEVKIERGRRRILGLF
 
Nucleotide Sequence: 912 bp     [Download]
>gi|291434858|ref|NC_007972.2|:c156634-155723 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGGAAGCTCGCACCCCCTCCCGGTTCATCCCTCTGGCCATTGCGCTGTGCATGGCCATGCTGCTTTCCG
CTCCGGACAGTCATGCGGCCGACAAAAATGCGCGTCGCACCGGCGCCGGCATGGCCGGACTGGGAATCGG
CGACCTCAGCGACGCTATGAATCCGGCCAATCCGTTCAATGGCGGCGTTGATCCGATCGCATTGCCGGGT
GACTCTCGGCTTGTGGTCTTCACCTACAGCCGAGATCAGATCTTCCGCGTGCTCAGCGCACCGCTGAAGA
TCACAACCATCGAATTTCCAGACGACGAACAGATCGTTGGCGATCCCGCCTGGGGCGAAAACGTGCGATG
GGACTACGACACGGACGGTGCCAATCATCTTTACGTGAAGCCGCAGGCGGCGGGGCTGGTCAACACGCTG
TCGGTCAATACGAACAAGCGGAGCTATGAGTTCACGCTCGTATCGTCTCCGCTCGGCGGCATTTTTTACC
AAAAGGTCCGGTTCAAGGTTCCGACGTCGATCTCCGCCAAGGTGAAGGCGCGCAACGACGCGCGTGGTGA
AGCGCCGGACGAAGCCAAGGGTGCAGAAGCCGAAGGATCGCGCAATCCGGATGCGGTTGGCGTTTCTCCC
GATCAACTGAATTTCGAGTATGCGATTTCGGGGAGCGCCAGTTTCAAGCCGGAAACTGCCTTTGACGATG
GCAAGGCGCTCTGGTTGCGCCTGCCCAACGCAGCGCTGCAGAACTGGCCGGTCGCTTTCATCAAGGACGG
CAGCGATTTCGTGGTGGTCAATGCCATCCGCCGTGGCGGGTACCTCGTGGTGCAGCGACTGGCTGATACC
GTCGTGCTGCGCTCGGGCGACGATGAAGTGAAGATCGAGCGCGGCCGCCGCCGCATCCTGGGGCTGTTCT
GA
 Primer design