SecReT4
Protein ID: 94152710
T4SS name [ID]Trb [773]
Gene symboltrbC
Locus tagRmet_6303
StrainCupriavidus metallidurans CH34
Repliconplasmid pMOL28 [GenBank: NC_007972] [Browse all T4SS(s) in this replicon]
Location [Strand]158827..159174 [+]
ProductVirB2 type IV secretion protein
Component typeTrbC
UniProt IDQ5NV44
KEGG IDrme:Rmet_6303
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.6e-07, Aligned region: 11..105
Protein Sequence: 115 a.a.     [Download]
>gi|94152710|ref|YP_582112.1| VirB2 type IV secretion protein [Cupriavidus metallidurans CH34]
MTLTFNHRVRATARKYAPSALLMVGMMAVATSAVAADDAFLNNLGNFICGIATFINTKYLFVVGLIVIVL
GAYAYANAESSLSKFISGACVGVGLAAAAPSILKSLGLIASCVGF
 
Nucleotide Sequence: 348 bp     [Download]
>gi|291434858|ref|NC_007972.2|:158827-159174 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGACCCTAACCTTCAACCACCGCGTGCGCGCCACCGCACGCAAGTACGCGCCCTCGGCCCTGCTGATGG
TCGGCATGATGGCTGTCGCCACGTCGGCGGTTGCCGCTGACGACGCATTCCTGAATAACCTCGGCAACTT
CATCTGTGGCATCGCGACGTTCATCAACACGAAGTATCTCTTCGTGGTGGGCCTGATCGTGATCGTCCTG
GGCGCCTACGCGTACGCGAACGCGGAGTCGTCCCTCTCCAAATTTATCTCCGGCGCCTGCGTCGGCGTGG
GTCTAGCGGCCGCTGCCCCTTCCATCCTGAAGTCGCTAGGCCTGATCGCCTCCTGTGTCGGTTTCTGA
 Primer design