SecReT4
Protein ID: 94152714
T4SS name [ID]Trb [773]
Gene symboltrbL
Locus tagRmet_6307
StrainCupriavidus metallidurans CH34
Repliconplasmid pMOL28 [GenBank: NC_007972] [Browse all T4SS(s) in this replicon]
Location [Strand]162743..163795 [+]
Productmating pair formation conjugal transfer protein
Component typeTrbL
UniProt IDQ5NV47
KEGG IDrme:Rmet_6307
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1e-28, Aligned region: 96..319
Protein Sequence: 350 a.a.     [Download]
>gi|94152714|ref|YP_582116.1| mating pair formation conjugal transfer protein [Cupriavidus metallidurans CH34]
MQIARFIVLLLTALLLHSPPAFAQASAPEAGTDTAQQTAPNKGGKPGLFAQPGSIGESLKSWLSQFESFR
TGLIGGATTLSKTLTPDADKIAFGLAVISLTLAGIRFAAASQPVAAWTEVFETLLMLGIFASLYTGYDKF
GPGIYEYFQHLADKIAGTQAMSPAMTLASVGAGFIDSYIESMKAASGISDVLMIAFAGMLLLAAFVFCAL
AALLYTFFISLGEIAAAIGIVIGPIAVALGFSDYSRRYFSSWLDYMIGASMYSVVAAVMARLVSSALVST
LIDQKSAGTATLAGAVYAMSIALFMILVAFELPKIAGAIFGSGGGISGGGAMRVGLKAAGGIGKFLAKLK
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|291434858|ref|NC_007972.2|:162743-163795 Cupriavidus metallidurans CH34 plasmid pMOL28, complete sequence
ATGCAGATCGCCCGCTTCATCGTCTTGCTTCTGACGGCCCTTCTATTGCATTCGCCGCCGGCTTTCGCAC
AAGCGTCCGCCCCTGAAGCGGGCACCGACACCGCACAGCAAACTGCCCCGAACAAGGGTGGCAAGCCCGG
GCTATTCGCGCAGCCGGGATCGATTGGTGAATCGCTCAAGAGCTGGCTCAGCCAGTTCGAATCGTTCCGT
ACCGGTCTGATCGGGGGCGCCACCACATTGAGCAAGACCCTCACTCCGGACGCGGACAAGATCGCCTTCG
GGCTTGCCGTCATTTCGCTGACGTTGGCTGGAATTCGTTTCGCCGCGGCGTCGCAACCTGTCGCGGCCTG
GACCGAGGTCTTCGAGACGCTCCTTATGCTTGGCATCTTCGCGTCCCTCTACACCGGATATGACAAGTTC
GGGCCTGGCATTTACGAATACTTCCAGCATCTCGCCGACAAAATCGCAGGCACACAAGCGATGTCACCTG
CGATGACGCTCGCTTCCGTCGGCGCCGGATTCATTGATTCCTATATTGAGTCTATGAAGGCGGCAAGCGG
TATCTCAGACGTCTTGATGATAGCGTTTGCTGGAATGCTGTTGCTGGCTGCGTTCGTTTTTTGCGCCCTC
GCAGCTCTTCTCTACACGTTTTTCATATCCCTGGGCGAGATTGCGGCAGCCATCGGAATTGTAATTGGAC
CTATCGCAGTCGCCCTCGGATTCTCCGACTATAGCCGTCGCTACTTCTCTTCGTGGCTGGACTATATGAT
CGGCGCATCGATGTATTCGGTCGTTGCCGCTGTGATGGCTCGCCTCGTCTCGAGTGCACTGGTGTCCACG
CTTATCGATCAGAAGAGCGCCGGCACAGCGACGCTGGCTGGTGCCGTGTATGCCATGAGCATTGCGCTGT
TCATGATTCTTGTCGCCTTCGAGCTTCCTAAAATCGCCGGTGCGATCTTCGGCTCCGGTGGTGGCATCAG
CGGCGGTGGGGCCATGCGGGTTGGCCTCAAGGCCGCCGGCGGCATCGGCAAGTTCCTTGCGAAGTTGAAA
TAA
 Primer design