SecReT4
Protein ID: 94310284
T4SS name [ID]Trb [262]
Gene symboltrbC
Locus tagRmet_1342
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1451805..1452188 [+]
Productconjugal transfer TrbC transmembrane protein
Component typeTrbC
UniProt IDQ1LNQ1
KEGG IDrme:Rmet_1342
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.3e-24, Aligned region: 31..117
Protein Sequence: 127 a.a.     [Download]
>gi|94310284|ref|YP_583494.1| trbC gene product [Cupriavidus metallidurans CH34]
MTQMTISAFRVSVNPALRLARLRSLARPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQGPV
ARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1451805-1452188 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACGCAGATGACCATTTCTGCTTTCCGTGTTTCCGTAAATCCGGCTTTGCGCCTTGCACGGCTGCGTA
GCCTGGCCCGCCCTGCTGGGCAAGGGCTGCTGCTGGCCGCGCTGCTGCTGTTCCTGGCCGGCACCGCGCA
GGCCGCCGGTTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATCCTCGAATCCATCCAGGGGCCGGTG
GCGCGCATCGTCGCGGTCATCATCATCATCGCAACCGGCCTCGCGCTGGCCTTCGGCGACACGTCGGGTG
GTTTCCGCAAGCTGATCCAGATCGTGTTCGGCCTGTCCATCGCGTTCGCGGCTTCGAGCTTCTTCCTGTC
GTTCTTCAGCTTCTCCGGCGGGGCCGTCGTATGA
 Primer design