SecReT4
Protein ID: 94310285
T4SS name [ID]Trb [262]
Gene symboltrbD
Locus tagRmet_1343
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1452185..1452457 [+]
Productconjugal transfer TrbD transmembrane protein
Component typeTrbD
UniProt IDQ1LNQ0
KEGG IDrme:Rmet_1343
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 5.6e-11, Aligned region: 6..84
Protein Sequence: 90 a.a.     [Download]
>gi|94310285|ref|YP_583495.1| trbD gene product [Cupriavidus metallidurans CH34]
MSGPDTFAAGFEVPLHRSLTEPILLGGAPRTVAIANGTLAAAVGLGLQLWIPGVVLWIVGHSLAVWGARV
DPQFMAVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1452185-1452457 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAGCGGCCCGGATACCTTCGCGGCTGGGTTCGAGGTGCCGCTGCATCGCTCGCTGACCGAGCCGATCC
TGCTGGGCGGTGCGCCGCGCACCGTGGCAATCGCCAACGGCACGCTGGCCGCCGCCGTCGGGCTAGGCCT
GCAACTGTGGATTCCTGGCGTCGTGCTCTGGATCGTCGGCCATTCGCTGGCGGTATGGGGCGCGCGCGTC
GATCCGCAGTTCATGGCCGTGTTCGCCCGGCACATCAAGCACCGCCCGCTGCTGGACGTGTGA
 Primer design