SecReT4
Protein ID: 94310289
T4SS name [ID]Trb [262]
Gene symboltrbL
Locus tagRmet_1347
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1455993..1457372 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ1LNP6
KEGG IDrme:Rmet_1347
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.1e-48, Aligned region: 37..264
Protein Sequence: 459 a.a.     [Download]
>gi|94310289|ref|YP_583499.1| trbL gene product [Cupriavidus metallidurans CH34]
MNDVTIIDQFLNTFATYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYILNNFNWLASIVFRSFAGLGITATGSAITMENFLQPGRLAKTGIDAGAPILEQIGEMAGFPEVF
VNLDPIVVMFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGVK
VLVLAVIVGIGSGLFAQFQVHPAEPSIDHALVIMLASLTLLALGIFGPGVATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGVGGAVAAGARMAPAAAKLAGSGARAATTAAGSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQAAGYAAASRASAAGQRMAAPFRAGWNGSMADAGASAGQASAGEAPAGDAAAQKPEQPAWA
KRLHRRQQLTHAATTAAHTLRGGDGGGSGQGPSLRGSDE
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1455993-1457372 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAGTTCCTCAACACCTTCGCCACCTACATCGACTCGGGTTTCGGAC
TGCTGCGGGGCGAAGTGGCGTTCCTCACGGCCACGCTGATCGTCATCGACATGACGATCGCCGGCCTGTA
TTGGGCCATGAGCCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTATATCCTCAACAACTTCAACTGGCTGGCCAGCATCGTGTTCCGCTCGTTCGCCG
GGTTGGGCATCACCGCCACCGGCTCGGCCATCACGATGGAGAACTTCCTCCAGCCGGGCCGGCTGGCCAA
GACCGGCATCGACGCCGGGGCGCCAATTCTGGAACAGATCGGCGAGATGGCCGGGTTTCCCGAGGTGTTC
GTGAACCTCGATCCCATCGTGGTGATGTTCCTCGCTTGGTTGGTCGTGGTCCTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAGTTCAAGCTGACCACACTCGCGGGCTTCGTGTTGGTGCCGTT
CGCGCTGTGGAACAAGACCAGCTTCCTCGCCGAGAAGGTGCTGGGCAACGTGGTGTCGTCCGGCGTCAAG
GTACTGGTGCTGGCCGTGATCGTGGGCATCGGCTCGGGCCTGTTCGCGCAGTTTCAAGTCCATCCCGCCG
AACCGTCCATCGACCACGCGCTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTGGGGATCTTCGG
CCCCGGCGTCGCCACGGGCCTCGTGTCCGGTGCGCCGCAGCTCGGCGCTGGCGCAATGGCCGGTGCTGCT
GTCGGCGCTGCCGGCACGGCTGTCGCCATCGGCGCCGCCGCGACGGGCGTGGGTGGCGCCGTGGCTGCTG
GCGCGCGCATGGCCCCGGCTGCCGCCAAGCTGGCCGGAAGCGGTGCGCGCGCCGCCACGACGGCGGCCGG
CAGTGCGAAGTCGGCGTTCCAGGCCGGTTCCGCCGCCGCTGGCGGCGGCGCAAAGGGCGCGATGGCGGGC
CTGGGCAACGTCGCCAAGACCGGCGCGCAGGCCGCCGGATACGCGGCTGCATCCCGTGCTTCCGCTGCCG
GGCAGCGGATGGCCGCTCCGTTCCGTGCTGGCTGGAATGGCTCGATGGCCGACGCTGGCGCGTCAGCCGG
CCAAGCCTCCGCAGGAGAAGCCCCCGCAGGCGACGCCGCTGCACAGAAGCCGGAACAACCCGCCTGGGCC
AAGCGGCTGCATCGCCGCCAGCAACTCACCCACGCCGCGACCACCGCCGCGCACACGCTGCGCGGCGGTG
ACGGTGGCGGCTCGGGGCAAGGCCCGAGCCTGCGCGGCTCCGACGAGTAA
 Primer design