SecReT4
Protein ID: 94310291
T4SS name [ID]Trb [262]
Gene symboltrbG
Locus tagRmet_1349
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1458098..1459090 [+]
Productconjugal transfer protein TrbG/VirB9/CagX putative exported protein
Component typeTrbG
UniProt IDQ1LNP4
KEGG IDrme:Rmet_1349
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-66, Aligned region: 103..322
Protein Sequence: 330 a.a.     [Download]
>gi|94310291|ref|YP_583501.1| trbG gene product [Cupriavidus metallidurans CH34]
MNDLFRKSALPVILLALVGCASQGKPPPTISLDEPVQAQPLPEPPAPVEVVAVPEVLPMPAQLKPLPEAE
DAKPAPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVITTSRRTYLLELASTEKTWMASVSWEYPRDRM
LALQRQAQAANAAAPVDAGLALENLRFRYAISGSNPPWKPLRAFDDGQKVYIQFPAGIAQGELPPLFVIG
PEGDGQLVNYRFRSPYYIVDRLFGAAELRLGGDKGAMVRIERTDGVARRN
 
Nucleotide Sequence: 993 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1458098-1459090 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAATGATCTTTTCCGTAAATCCGCTTTGCCGGTGATCCTGCTTGCCCTCGTGGGCTGCGCCTCGCAGG
GCAAGCCACCGCCGACCATCTCGCTCGATGAGCCGGTGCAGGCCCAGCCGCTGCCGGAGCCGCCCGCGCC
GGTGGAGGTGGTGGCCGTGCCCGAGGTTCTACCGATGCCGGCGCAGTTGAAGCCGTTGCCCGAAGCTGAG
GACGCCAAACCTGCGCCGGAGCCGGCTGACGAGAAGGTGCGCGTCTCGCGCGCCAATGCCGAGGCCCGCG
TAGCCCCCACGCGCGAGGGCTACGTCAATGCGATTCAGGTTTGGCCCTTCACGGACGGGGCGCTCTATCA
GGTCTATGCGGCCGTGGGCCGCGTGACCGTGGTTTCGCTCCAGCCGGGCGAGGAACTGGTGACGGTGGCC
GCTGGCGATACCGTGCGCTGGATCGTGGGCGACACGTCCAGCGGCAGCGGTGCCGATCTGCGCGTGAACG
TGCTGGTCAAGCCGATTCGCTCAGGCCTCAAGACCAATCTCGTCATCACCACCAGCCGCAGGACGTACCT
GCTGGAGCTGGCTTCGACGGAAAAGACGTGGATGGCGTCGGTGTCCTGGGAGTACCCGCGCGACCGGATG
CTGGCGCTACAGCGCCAAGCGCAGGCGGCCAATGCCGCCGCGCCGGTCGATGCCGGGCTGGCGCTAGAGA
ACCTGCGCTTCCGCTACGCAATCAGCGGCAGCAATCCGCCGTGGAAGCCGTTGCGCGCCTTCGACGACGG
GCAGAAGGTCTATATCCAGTTCCCCGCTGGCATCGCGCAAGGCGAGCTGCCGCCGCTGTTCGTGATAGGG
CCGGAAGGCGACGGGCAACTGGTGAACTACCGCTTCCGCTCGCCGTACTACATCGTGGATCGCCTCTTTG
GCGCGGCAGAGCTGCGCCTGGGCGGCGACAAGGGCGCCATGGTGCGGATCGAGCGCACGGATGGCGTGGC
ACGGAGGAACTGA
 Primer design