SecReT4
Protein ID: 94310430
T4SS name [ID]Trb [263]
Gene symboltraF
Locus tagRmet_1488
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1607397..1607984 [+]
Productplasmid conjugal transfer transmembrane protein
Component typeTraF
UniProt IDQ1LNA5
KEGG IDrme:Rmet_1488
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.7e-55, Aligned region: 46..190
Protein Sequence: 195 a.a.     [Download]
>gi|94310430|ref|YP_583640.1| traF gene product [Cupriavidus metallidurans CH34]
MTAVSPADTAPRPRSRLHARIVLAGLSACGLAALAWASFVHPLPRLTYNPSDSVAVGWYRVDPLDHRASS
PPRPLSVGSIVLVPLPAEAAALAAQRGYLPTRIPLLKRVGAVAPQEVCIADGSVRIDGVPSAAVLPADRL
GRPLPSWQQCRRLRSGELFLLSVINPASFDSRYFGPVSAATVIGVARPIWLESRP
 
Nucleotide Sequence: 588 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1607397-1607984 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACCGCCGTTTCCCCTGCCGACACCGCGCCGCGTCCTCGCTCGCGCCTACACGCTCGCATCGTGCTGG
CGGGCCTGTCCGCCTGCGGCCTCGCTGCGCTGGCCTGGGCGTCCTTCGTGCATCCACTGCCGCGCCTAAC
CTACAACCCGTCCGACAGCGTGGCGGTAGGCTGGTATCGCGTCGATCCACTCGACCACCGCGCCAGCTCG
CCGCCTCGTCCGTTGTCCGTGGGCAGCATCGTGCTGGTTCCACTGCCTGCCGAAGCCGCAGCACTCGCTG
CGCAGCGCGGCTACCTGCCGACGCGCATCCCGCTGCTCAAGCGCGTCGGCGCGGTCGCGCCGCAGGAGGT
GTGCATCGCTGACGGCAGCGTCCGCATCGACGGCGTGCCTTCGGCCGCCGTGTTGCCTGCTGACCGGCTG
GGACGGCCGCTGCCATCCTGGCAGCAGTGCCGCCGCCTTCGGTCTGGCGAGCTGTTCCTGCTCAGTGTCA
TCAATCCGGCGTCGTTCGACAGCCGGTATTTTGGGCCGGTCAGCGCCGCCACCGTGATCGGCGTTGCACG
TCCGATCTGGCTGGAGTCACGCCCATGA
 Primer design