SecReT4
Protein ID: 94310490
T4SS name [ID]Trb [263]
Gene symboltraG
Locus tagRmet_1548
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1670131..1672125 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDQ1LN45
KEGG IDrme:Rmet_1548
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-103, Aligned region: 106..553
TraG-D_C [PF12696], Evalue: 2.8e-31, Aligned region: 399..519
TrwB_AAD_bind [PF10412], Evalue: 1.2e-30, Aligned region: 167..534
Protein Sequence: 664 a.a.     [Download]
>gi|94310490|ref|YP_583700.1| traG gene product [Cupriavidus metallidurans CH34]
MLFGQIAVVFGIVIAGVWGATQWTAAALGYQLRLGSPWFDLLGTPIYHPWKLFEWWFFFDAYAPRVFDTG
GAIAGGSGLLAVVVAIGMSIWRSRQSRLVTTYGSARWANAGDIHKAGLTQPAGVFLGQHDRQYLRHEGPE
HVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKGENWQITAGWRSRFSHCLLFNPTDAKSAAYNPLLEV
RRGAHEVRDVQNIADILVDPEGALEKRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPASPFEL
TLHRMMTTLHLGDGPHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEITSRCDWRIADLIAA
EHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIQRRHKLLLMLDEFPALGRLDFFETALA
FMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLGTATELRAQRNYAGHR
LAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKAKKLRYYADANFKRRVLPPPTLANGQ
YADAPPLRSDDWSGLAIPAGPTAPATASADGLEDLGTADDGGPRRQPELSETVAYDPELAAPAADLGLLD
DDDDLPLPLPRQLDLAMHRTARLASLDPNDGIEL
 
Nucleotide Sequence: 1995 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1670131-1672125 Cupriavidus metallidurans CH34 chromosome, complete genome
GTGCTGTTCGGTCAGATTGCCGTGGTATTCGGCATCGTGATCGCCGGCGTGTGGGGCGCCACACAATGGA
CAGCAGCCGCCCTTGGCTATCAGCTACGCCTTGGCTCGCCCTGGTTCGATCTTCTCGGCACGCCGATATA
CCACCCGTGGAAGCTGTTCGAGTGGTGGTTCTTCTTCGACGCCTACGCGCCGCGCGTGTTCGATACCGGT
GGCGCCATCGCGGGCGGCAGCGGCCTGCTCGCGGTGGTGGTTGCCATCGGCATGTCGATATGGCGCTCGC
GGCAGTCGCGCCTGGTCACGACCTACGGCTCGGCCCGTTGGGCGAACGCGGGGGATATTCACAAAGCCGG
CCTCACGCAGCCTGCCGGCGTGTTCCTGGGCCAGCACGACCGCCAGTACCTTCGCCACGAAGGCCCGGAA
CACGTCCTGACCTTCGCGCCCACGCGCAGCGGCAAAGGTGTCGGCCTGGTGGTGCCGACGCTGCTTTCCT
GGCCTGCGTCCGCCGTCATCCACGACATCAAGGGCGAGAACTGGCAGATCACCGCCGGCTGGCGCTCGCG
CTTCTCGCATTGCCTGCTGTTCAACCCCACCGATGCGAAGTCGGCCGCCTACAACCCGCTGCTGGAGGTT
CGCCGCGGCGCGCATGAGGTGCGCGACGTGCAGAACATCGCGGACATTCTGGTCGATCCCGAAGGCGCGC
TGGAGAAGCGAAACCATTGGGAAAAGACCAGCCACGCGCTGCTGGTCGGGGCCATCCTGCATGTGCTCTA
CGCGGGCGAGGACAAGACGCTGCGCGGCGTCGCCAACTTCCTCTCCGACCCGGCCAGCCCCTTCGAGCTG
ACCTTGCACCGGATGATGACCACGCTTCACCTCGGCGATGGCCCACATCCGGTAGTGGCGTCCGCTGCGC
GCGAAGTGCTCAACAAGTCGGACAACGAGCGTTCCGGCGTATTGAGCACCGCCATGTCGTTCTTGGGCCT
CTACCGTGATCCGACGGTGGCCGAAATCACGTCGCGCTGCGACTGGCGCATTGCCGACCTGATCGCGGCC
GAGCATCCGGTGTCGCTGTACCTGGTGGTGCCGCCTTCGGACATTTCGCGGACGAAGCCGCTCATCCGCC
TGATCCTCAACCAGATCGGGCGGCGGCTCACCGAATCGCTCGATGGCTCCGACGGCATTCAGCGCCGCCA
CAAGCTGCTGCTGATGCTCGATGAGTTCCCGGCGCTGGGGCGCCTGGACTTCTTCGAGACGGCGCTGGCC
TTCATGGCCGGCTACGGCATCCGCAGCTTCCTCATCGCGCAGTCGCTCAACCAGATCGACAAGGCGTATG
GGCAGAACCATTCGATTCTGGACAACTGCCATGTGCGCGTGACGTTCGCCACGAACGACGAACGCACCGC
CAAGCGGATTTCCGAGACGCTGGGCACAGCGACCGAACTGCGCGCCCAGCGCAACTACGCGGGCCACCGG
CTCGCGCCGTGGTTGGGCCACCTGATGGTGTCGCGCCAGGAAACCGCGCGCCCGCTGCTGACGCCGGGCG
AAGTCATGCAGCTTCCGCCTGACGAGGCGGTGGTGATGGTGTCCAGCGTGGCGCCGATCAAGGCGAAGAA
GCTGCGCTACTACGCGGACGCCAATTTCAAGCGTCGCGTGCTGCCGCCGCCCACGCTGGCGAACGGGCAG
TACGCAGACGCGCCGCCATTGCGATCCGACGACTGGAGTGGGCTGGCGATTCCTGCTGGGCCCACCGCAC
CAGCCACGGCATCCGCCGATGGCCTGGAGGACTTGGGTACGGCCGACGACGGCGGCCCGCGCCGTCAGCC
CGAACTCTCCGAAACCGTCGCTTACGACCCCGAGCTGGCCGCTCCCGCGGCCGACCTTGGGCTGCTCGAT
GACGACGACGACCTGCCGCTTCCGCTTCCTCGCCAGCTCGATCTAGCCATGCATCGCACGGCCCGGCTGG
CTTCCCTCGACCCCAACGACGGAATCGAGCTATGA
 Primer design