SecReT4
Protein ID: 94310492
T4SS name [ID]Trb [263]
Gene symboltrbB
Locus tagRmet_1550
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1672583..1673659 [+]
ProductP-type conjugative transfer ATPase TrbB
Component typeTrbB
UniProt IDQ1LN43
KEGG IDrme:Rmet_1550
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.8e-81, Aligned region: 31..297
FtsK_SpoIIIE [PF01580], Evalue: 1.6e-06, Aligned region: 149..213
TrwB_AAD_bind [PF10412], Evalue: 1.8e-06, Aligned region: 149..190
Protein Sequence: 358 a.a.     [Download]
>gi|94310492|ref|YP_583702.1| trbB gene product [Cupriavidus metallidurans CH34]
MSARISIEGQSMSATSLDRRIQMLRTAMGPLIAAALEDPDVVEVMLNPDRTLWVDRLSSGRAPMGVELPE
ADGERIIRLVAAHVGAEVHRGQPLLSAELPETGERFEGILPPAAPGPAFALRKRAIGVIPLERYVVEGMM
TAAQAGFLVRAVRERQNVLIAGATSSGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVPLRTRAG
VVSMTELVRSSMRLRPDRVVVGEVRGAEALDLIKVWGTGHPGGIATIHAGSALGALLRLEQLILEVAVNP
PRALIAEAVNVVIHIAGRGRKRRIESIARVVGFDGVGYRLVDWEADALDTPFPELPPLPDAAPAAATFPS
PDSLGELP
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1672583-1673659 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAGCGCCCGAATCTCCATTGAAGGGCAGTCCATGAGTGCCACGTCGCTCGACCGCCGCATCCAGATGC
TGCGCACGGCGATGGGGCCGCTGATCGCCGCCGCGCTCGAAGACCCGGACGTGGTGGAGGTGATGCTGAA
TCCCGATCGCACCCTTTGGGTGGATCGGCTTTCCAGTGGGCGCGCGCCGATGGGCGTGGAACTGCCCGAG
GCGGACGGCGAGCGAATCATCCGCCTCGTGGCCGCCCACGTTGGCGCGGAAGTCCATCGCGGCCAGCCGC
TGCTGTCCGCCGAGTTGCCCGAGACGGGCGAACGCTTCGAGGGCATTTTGCCGCCGGCAGCGCCGGGGCC
GGCCTTCGCGCTGCGCAAGCGGGCCATCGGCGTGATTCCGCTGGAGCGCTACGTCGTGGAGGGAATGATG
ACCGCCGCACAGGCGGGCTTTCTCGTTCGCGCCGTACGCGAGCGGCAGAACGTGCTGATCGCCGGCGCCA
CCAGCAGCGGCAAGACGACCTTGGCGAACGCGCTGCTGGCCGAGATCGCCGCCACCGGCGACCGCGTGCT
GGTGCTCGAAGACACTGTGGAACTGCAATGCGCGGCCCGCGACCACGTTCCGCTGCGCACACGCGCGGGC
GTGGTGTCCATGACGGAGCTGGTGCGCTCGTCCATGCGACTGCGGCCCGATCGTGTCGTCGTCGGCGAGG
TGCGCGGCGCCGAGGCGCTGGATCTCATCAAGGTCTGGGGCACGGGCCACCCCGGCGGCATCGCCACGAT
CCACGCCGGCTCCGCGCTCGGCGCGCTGCTGCGCCTGGAGCAACTGATTCTCGAAGTGGCGGTGAACCCG
CCCCGCGCGCTGATCGCGGAAGCGGTCAACGTGGTGATCCACATCGCCGGGCGCGGGCGCAAACGCCGCA
TCGAGAGCATCGCCCGCGTCGTCGGCTTCGACGGCGTGGGCTACAGGCTGGTGGATTGGGAGGCGGATGC
ACTGGACACGCCGTTTCCCGAGCTGCCGCCGCTTCCCGATGCCGCACCCGCTGCGGCGACTTTCCCATCC
CCTGACTCACTTGGAGAACTGCCATGA
 Primer design