SecReT4
Protein ID: 94310493
T4SS name [ID]Trb [263]
Gene symboltrbC
Locus tagRmet_1551
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1673656..1674039 [+]
Productmating pair formation conjugal transfer TrbC transmembrane protein
Component typeTrbC
UniProt IDQ1LN42
KEGG IDrme:Rmet_1551
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4.8e-24, Aligned region: 32..117
Protein Sequence: 127 a.a.     [Download]
>gi|94310493|ref|YP_583703.1| trbC gene product [Cupriavidus metallidurans CH34]
MTQMTIPAFRFSANPALRLARLRCLARPAGQGLLLAALLLFLAGTAQAAGSSMPWEGPLQSILESIQGPV
ARIVAVIIIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFSGGAVV
 
Nucleotide Sequence: 384 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1673656-1674039 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACGCAGATGACCATTCCTGCTTTCCGTTTTTCTGCAAATCCGGCTTTGCGTCTTGCGCGGCTGCGCT
GCCTGGCCCGCCCTGCGGGGCAAGGGCTGCTGCTGGCCGCGCTGCTGCTGTTCCTGGCCGGAACCGCGCA
GGCCGCCGGCTCCTCGATGCCGTGGGAAGGCCCGCTGCAATCCATTCTCGAATCCATCCAGGGGCCGGTG
GCGCGCATCGTCGCGGTCATCATCATCATCGCCACGGGCCTCGCGCTTGCGTTCGGCGACACGTCGGGCG
GCTTTCGCAAGCTGATCCAGATCGTGTTCGGCCTGTCCATCGCGTTCGCGGCTTCGAGCTTCTTCCTGTC
GTTCTTCAGCTTCTCCGGCGGGGCGGTCGTATGA
 Primer design