SecReT4
Protein ID: 94310494
T4SS name [ID]Trb [263]
Gene symboltrbD
Locus tagRmet_1552
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1674036..1674308 [+]
Productputative conjugal transfer transmembrane protein
Component typeTrbD
UniProt IDQ1LN41
KEGG IDrme:Rmet_1552
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 3e-11, Aligned region: 6..84
Protein Sequence: 90 a.a.     [Download]
>gi|94310494|ref|YP_583704.1| trbD gene product [Cupriavidus metallidurans CH34]
MSAPDTFADGFEVPLHRSLTEPILLGGAPRTVAIANGTLTAAVGLGLQLWIPGVVLWIVGHSLAVWGARV
DPQFMQVFARHIKHRPLLDV
 
Nucleotide Sequence: 273 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1674036-1674308 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAGTGCCCCGGACACCTTCGCGGACGGTTTCGAGGTGCCGCTGCATCGCTCGCTGACCGAGCCGATTC
TGCTGGGCGGTGCGCCGCGCACCGTGGCGATCGCCAACGGCACGCTGACCGCCGCTGTCGGCCTGGGCCT
GCAACTGTGGATTCCCGGCGTGGTGCTCTGGATCGTCGGCCATTCGCTGGCGGTGTGGGGTGCGCGCGTC
GATCCGCAGTTCATGCAGGTCTTCGCCCGGCACATCAAGCACCGCCCGCTGCTGGACGTGTGA
 Primer design