SecReT4
Protein ID: 94310495
T4SS name [ID]Trb [263]
Gene symboltrbE
Locus tagRmet_1553
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1674324..1676753 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ1LN40
KEGG IDrme:Rmet_1553
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.3e-38, Aligned region: 442..708
CagE_TrbE_VirB [PF03135], Evalue: 1.1e-16, Aligned region: 299..388
DUF853 [PF05872], Evalue: 3.5e-07, Aligned region: 613..684
Protein Sequence: 809 a.a.     [Download]
>gi|94310495|ref|YP_583705.1| trbE gene product [Cupriavidus metallidurans CH34]
MLNLAEYRQRPALLADWLPWAGLVAPGIVLNKDGSFQRTARFRGPDLDSATQGELIATSARLNNALRRLG
SGWALFIEAERRAAADYPRSEFPEPLSWVVEEERRAAFEDSGNHFESGYHLTLLYLPPEESRARAAKMLY
ENTPTNGVDWRERLQAFVAETDRVFDLLDGVMPEVDWLDDAQTLTYLHATISTRRYSLAVPEVPFHIDAL
LTDSPLVGGLAPMLGDQHLRVVSVRGFPTSTWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELSRLRRQ
WFAKRKNVIALLRETIFQQESPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDTDAAVADEKL
RMVERVIQGRGFVTIPETLNAVDAWLSSIPGNAYANVRQPIVSTLNLAHLMPVSAVWAGPERNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGHTLVAGPTGMGKSVLLATLAMQFRRYPGSRIFAFDMGRSMRATILGLG
GEHYDLGTDGEIAFQPLARIDREGYRTWAAEWIEGRLLHEGVAVGPEEKAAIWSALGSLAGAPVEQRTMT
GLSVLLQSNALRQALSPYVLGGAHGKLLDADHDRLGMADVQCFEMEELMHSKAAVMAVLHYLFARFDERF
DGAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIKDSSIAPAIIESCASRIFLPN
PQATEPQIHTIYEGFGLNRRQIEIVATAQPKRDYYYQSRLGNRLFDLDLGPAALAFAGASTPQDQRDMDR
VLLDAGVPGFADAWLRHRGLDWAADLLPSFTDHPQENLP
 
Nucleotide Sequence: 2430 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1674324-1676753 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCTGAACCTCGCCGAATACCGCCAGCGCCCGGCCTTGCTTGCCGACTGGCTGCCCTGGGCCGGACTGG
TCGCGCCGGGCATCGTCTTGAACAAGGACGGCAGTTTCCAGCGCACGGCCCGGTTTCGCGGGCCTGACCT
CGACAGCGCGACGCAAGGCGAGCTGATTGCCACGTCGGCACGGCTGAACAACGCATTGCGCCGGCTGGGT
TCTGGCTGGGCCTTGTTCATCGAGGCCGAGCGCCGCGCCGCTGCCGACTATCCGCGCTCGGAGTTTCCCG
AGCCGCTTTCGTGGGTGGTGGAGGAAGAACGCCGGGCCGCCTTCGAGGACTCGGGCAATCACTTCGAGAG
CGGCTACCACCTGACGCTGCTTTACCTGCCGCCGGAAGAATCCCGCGCCCGTGCAGCCAAGATGCTCTAC
GAGAACACGCCGACGAATGGCGTGGACTGGCGCGAGCGGCTGCAAGCCTTCGTCGCGGAAACGGATCGCG
TCTTTGACCTGCTCGACGGCGTGATGCCGGAAGTTGACTGGCTCGATGACGCGCAGACGCTGACCTACCT
GCACGCGACCATCTCGACGCGGCGCTATTCGCTGGCGGTGCCCGAAGTGCCGTTCCACATCGACGCGCTG
CTGACCGACTCGCCGCTGGTCGGTGGCCTGGCGCCCATGCTGGGCGACCAGCACCTGCGCGTGGTGTCAG
TGCGGGGCTTCCCAACCTCGACCTGGCCGGGGATTCTGGACGACCTCAACCGCCTCGGTTTTGCGTACCG
CTGGAGCACGCGCTTTCTCTGCCTCGACAAAGCCGAGGCGGAGAAAGAGCTTTCCCGCCTGCGCCGCCAG
TGGTTCGCCAAGCGCAAGAACGTCATCGCGCTGCTGCGCGAAACGATCTTCCAGCAGGAAAGCCCGCTGG
TCGATACCGACGCCAACAACAAGGCCGCCGATGCCGACGCCGCCTTGCAGGAGCTGGGCAGCGATCAAGT
CGCCTTCGGCTACCTGACGGCGACCGTGACCGTCATGGACACGGACGCCGCCGTGGCGGACGAGAAGCTG
CGCATGGTGGAGCGTGTCATCCAGGGTCGGGGTTTCGTCACCATCCCCGAAACGCTCAACGCCGTGGATG
CCTGGTTGTCCTCGATCCCCGGCAATGCCTACGCCAACGTGCGCCAGCCCATCGTCTCGACGTTGAACCT
GGCGCACCTGATGCCGGTGTCGGCGGTATGGGCTGGCCCCGAGCGCAATGACCACCTCGACGGCCCGCCG
CTGATCGTCACGCGCACCGATGGCGCCACGCCGTTCCGGCTGGTGACGCACATCGGCGACGTGGGCCACA
CGCTGGTGGCCGGGCCGACCGGCATGGGCAAATCGGTGCTGCTCGCCACCTTGGCAATGCAGTTCCGGCG
CTACCCCGGCTCGCGCATCTTCGCCTTCGACATGGGGCGCTCGATGCGGGCCACCATCCTGGGCCTCGGT
GGCGAGCACTACGACCTGGGCACGGATGGCGAAATCGCCTTCCAGCCGCTCGCGCGCATCGACCGCGAGG
GCTACCGCACCTGGGCGGCCGAATGGATCGAGGGCCGCTTGCTGCACGAAGGCGTGGCTGTCGGCCCAGA
GGAGAAGGCGGCCATCTGGTCGGCGCTGGGAAGTCTCGCCGGTGCGCCGGTGGAGCAGCGCACGATGACG
GGCCTGTCGGTGCTGTTGCAATCGAATGCGCTGCGCCAGGCGCTGTCGCCCTATGTGCTCGGTGGCGCCC
ACGGCAAGCTGCTGGACGCCGACCACGACCGGCTCGGTATGGCCGACGTGCAGTGCTTCGAGATGGAGGA
GCTGATGCACAGCAAGGCCGCCGTCATGGCCGTGCTGCATTACCTCTTTGCACGCTTCGATGAACGCTTC
GACGGGGCGCCCACGCTGCTGATCCTCGATGAAGCGTGGTTGTTTCTCGATGACCCGGTGTTTGCCGCGC
GTATCCGGCAATGGCTCAAGACGCTGCGCAAGAAGAACGTGAGCGTCATCTTCGCCACGCAGAGCTTGGC
CGACATCAAGGATTCGAGCATCGCCCCGGCCATCATCGAGAGCTGCGCGAGCCGCATCTTCCTGCCGAAC
CCGCAGGCGACCGAACCGCAGATTCACACGATCTACGAGGGCTTCGGGCTCAACAGGCGGCAGATCGAAA
TCGTCGCCACTGCGCAGCCCAAACGCGACTACTACTACCAATCACGCCTCGGCAACCGCCTATTCGACCT
CGACCTGGGGCCGGCGGCGCTGGCCTTCGCGGGCGCGTCCACGCCGCAAGACCAGCGCGACATGGATCGC
GTGCTGCTGGACGCCGGCGTGCCCGGCTTCGCGGACGCCTGGCTGCGCCATCGCGGCCTCGATTGGGCGG
CTGACCTGCTGCCTTCGTTCACCGACCACCCACAGGAGAACCTGCCATGA
 Primer design