SecReT4
Protein ID: 94310496
T4SS name [ID]Trb [263]
Gene symboltrbJ
Locus tagRmet_1554
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1676750..1677475 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ1LN39
KEGG IDrme:Rmet_1554
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 1.1e-11, Aligned region: 2..38
Protein Sequence: 241 a.a.     [Download]
>gi|94310496|ref|YP_583706.1| trbJ gene product [Cupriavidus metallidurans CH34]
MKKRLIAAAIAAMLCTATAHAQWVVIDPTNLVQNTLTAIRTLEQINNQIKQLQNEAQMLINQARNLASLP
SSVVNQLRTNLATTERLIAQARGLAYDVTNLDREFQRLYPEQYAATVSGDQMYRDAQERWKNTLNGLQTT
MQMQAQASQNLHDDEGVLADLVGKSQSAVGALQAMQATNQLLALQAKQSIQTQRLQITQDRAASLELARQ
AAATERAREVRRRFLGEGTPYTPQSVNFYGN
 
Nucleotide Sequence: 726 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1676750-1677475 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAAGAAGCGCCTTATCGCCGCCGCCATCGCGGCCATGCTTTGCACCGCCACCGCCCATGCGCAATGGG
TCGTGATCGACCCCACGAACCTCGTGCAGAACACGCTGACCGCGATCCGCACACTGGAGCAGATCAATAA
CCAGATCAAGCAGCTTCAGAACGAAGCACAGATGCTCATCAATCAGGCGCGCAACCTGGCCAGCCTGCCG
TCCAGCGTGGTGAACCAGTTGCGCACCAATCTGGCGACGACCGAGCGGCTGATCGCCCAAGCTCGCGGCT
TGGCCTACGACGTGACGAATCTGGATCGGGAGTTTCAGCGCCTGTATCCCGAGCAGTACGCTGCCACGGT
GAGCGGCGACCAGATGTACCGCGACGCGCAGGAGCGTTGGAAGAACACGCTCAATGGCTTGCAGACCACG
ATGCAGATGCAGGCCCAGGCATCGCAGAACCTCCATGATGATGAAGGCGTGCTGGCCGATCTGGTCGGCA
AGAGCCAGTCCGCCGTTGGCGCACTGCAAGCCATGCAGGCCACGAACCAACTGCTGGCCTTGCAAGCCAA
GCAGTCCATCCAGACCCAGCGGCTCCAGATCACGCAGGACCGGGCGGCGTCGCTGGAGCTGGCGCGGCAG
GCGGCGGCCACGGAGCGCGCCCGCGAGGTGCGGCGGCGTTTCCTCGGTGAAGGTACGCCGTACACGCCGC
AGTCCGTGAACTTCTACGGCAACTGA
 Primer design