SecReT4
Protein ID: 94310498
T4SS name [ID]Trb [263]
Gene symboltrbL
Locus tagRmet_1556
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1677817..1679202 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ1LN37
KEGG IDrme:Rmet_1556
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.8e-48, Aligned region: 37..264
Protein Sequence: 461 a.a.     [Download]
>gi|94310498|ref|YP_583708.1| trbL gene product [Cupriavidus metallidurans CH34]
MNDVTIIDQFLNTFSTYIDSGFGLLRGEVAFLTATLIVIDMTIAGLYWAMSHATGQGEDVIAKLLRKVLY
VGAFAYIINNFNWLAGIVFRSFAGLGITATGSAITMGNFLQPGRLAKAGIDAGAPILKQIGKMAGFPEVF
VNLDPIVVMFLAWLVVVLCFFVLAIQLFITLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSAGVK
VLVLAVIVGIGSGLFAQFQVHPAEPSIDHALVIMLASLTLLALGIFGPGIATGLVSGAPQLGAGAMAGAA
VGAAGTAVAIGAAATGVGGAVAAGARMAPAAAKLAGSGARAATSAASSAKSAFQAGSAAAGGGAKGAMAG
LGNVAKTGAQSAGRAAVSRASAAGQRMAAPFRAGWNGPAADSGATAGGAGASGQAATGEATSGAANAQPA
WAKRLHRRQQLTHAATTTAHTLRGGDGGGSGQGPSLRDSDS
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1677817-1679202 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAATGACGTGACCATCATCGACCAGTTCCTGAACACCTTTTCCACCTACATCGACTCGGGTTTCGGGC
TGCTGCGGGGCGAAGTGGCGTTCCTCACGGCCACGCTGATCGTCATCGACATGACGATCGCCGGCCTGTA
TTGGGCCATGAGCCATGCCACCGGCCAGGGCGAGGACGTGATCGCCAAGCTGCTGCGCAAGGTGCTCTAC
GTCGGTGCCTTCGCCTACATCATCAACAACTTCAACTGGCTGGCCGGCATCGTCTTCCGATCCTTTGCCG
GACTGGGCATCACCGCCACCGGCTCGGCCATCACGATGGGGAACTTCTTGCAGCCGGGCCGGTTGGCGAA
AGCCGGCATCGACGCCGGGGCGCCGATCCTGAAGCAGATCGGCAAGATGGCGGGCTTCCCCGAAGTGTTC
GTGAACCTCGACCCCATCGTGGTGATGTTCCTCGCCTGGCTGGTTGTGGTGTTGTGCTTCTTCGTGCTGG
CGATCCAGCTTTTCATCACGCTGATCGAATTCAAGCTGACCACGCTGGCGGGCTTCGTGCTGGTGCCGTT
CGCGCTGTGGAACAAGACCAGCTTCCTGGCCGAGAAGGTGCTGGGCAACGTGGTATCCGCCGGCGTCAAG
GTGCTGGTGCTGGCCGTGATCGTCGGTATCGGCTCGGGCTTGTTCGCTCAGTTCCAAGTCCATCCCGCCG
AGCCGTCCATCGACCATGCGCTGGTCATCATGCTGGCCTCGCTCACCTTGCTGGCGCTTGGGATCTTCGG
CCCCGGCATCGCCACGGGCCTCGTCTCCGGTGCGCCACAGCTCGGCGCGGGCGCAATGGCCGGTGCTGCT
GTCGGCGCTGCCGGCACCGCCGTCGCCATCGGCGCCGCCGCGACGGGCGTGGGTGGCGCCGTGGCTGCTG
GCGCTCGCATGGCCCCGGCTGCCGCCAAGCTGGCCGGTAGCGGCGCGCGCGCCGCCACGTCGGCGGCCAG
CAGTGCGAAGTCGGCGTTTCAGGCCGGTTCCGCCGCCGCTGGCGGCGGCGCGAAGGGCGCGATGGCGGGC
CTGGGCAATGTCGCCAAGACAGGCGCGCAGTCGGCCGGACGCGCGGCTGTGTCGCGTGCTTCCGCTGCCG
GGCAGCGAATGGCAGCTCCATTCCGCGCTGGCTGGAATGGCCCGGCCGCTGACTCTGGCGCGACAGCCGG
CGGAGCCGGGGCATCCGGCCAGGCCGCAACAGGCGAAGCCACTTCCGGCGCAGCCAACGCGCAACCCGCC
TGGGCCAAGCGGCTGCATCGCCGCCAGCAACTCACCCATGCCGCGACCACCACCGCCCACACGCTGCGCG
GTGGCGATGGCGGCGGCTCCGGCCAGGGGCCGAGCCTGCGCGATTCCGATTCATAA
 Primer design