SecReT4
Protein ID: 94310499
T4SS name [ID]Trb [263]
Gene symboltrbF
Locus tagRmet_1557
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1679215..1679919 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ1LN36
KEGG IDrme:Rmet_1557
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-61, Aligned region: 23..225
Protein Sequence: 234 a.a.     [Download]
>gi|94310499|ref|YP_583709.1| trbF gene product [Cupriavidus metallidurans CH34]
MRFKKPQVRYADTPQAATPYQAAGQVWDERIGSPRVQAKNWRLMAFGCLTLALLMAGGLVWRSAQSIVTP
YVVEVDNAGQVRAVGEAATPYRPNDAQTAHHIARFVTLVRSLSIDPIVVRQNWLDAYDYTTDKGAVALND
YARVNDPFARIGKESVTVQIASVTRASDTSFNVRWTERRYVNGAAAGTERWNAVISIVQQTPRTEERLRK
NPLGIYVNGLSWSRELDSSEGAKP
 
Nucleotide Sequence: 705 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1679215-1679919 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCGATTCAAGAAACCACAGGTGCGCTATGCCGACACGCCGCAGGCTGCCACGCCTTATCAAGCTGCCG
GCCAGGTGTGGGACGAGCGCATCGGCTCGCCGCGCGTGCAGGCGAAGAACTGGCGGCTGATGGCCTTCGG
CTGCCTGACGCTCGCGCTGCTGATGGCCGGCGGCCTGGTGTGGCGCTCGGCGCAGTCCATCGTGACGCCC
TATGTGGTGGAGGTGGACAACGCGGGCCAAGTGCGCGCCGTGGGCGAAGCCGCCACGCCTTACCGGCCCA
ACGATGCGCAGACGGCGCACCACATCGCGCGCTTCGTGACGCTGGTGCGCTCGCTGTCCATCGACCCCAT
TGTCGTCCGCCAGAACTGGCTGGACGCCTACGACTACACCACCGACAAGGGCGCCGTGGCGCTCAACGAC
TACGCCCGCGTGAACGATCCGTTCGCGCGCATCGGCAAGGAGTCGGTGACGGTGCAGATCGCCAGCGTGA
CCCGTGCCAGCGACACGTCTTTCAACGTGCGCTGGACGGAACGGCGCTACGTCAACGGCGCTGCCGCAGG
CACTGAACGCTGGAACGCCGTGATTTCCATCGTGCAGCAGACCCCACGCACCGAGGAACGCCTACGCAAG
AACCCTCTCGGCATTTACGTCAATGGCCTGTCGTGGAGCCGCGAACTGGATTCTTCCGAAGGAGCAAAAC
CATGA
 Primer design