SecReT4
Protein ID: 94310500
T4SS name [ID]Trb [263]
Gene symboltrbG
Locus tagRmet_1558
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1679916..1680917 [+]
Productconjugal transfer protein
Component typeTrbG
UniProt IDQ1LN35
KEGG IDrme:Rmet_1558
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3e-66, Aligned region: 103..322
Protein Sequence: 333 a.a.     [Download]
>gi|94310500|ref|YP_583710.1| trbG gene product [Cupriavidus metallidurans CH34]
MSLSFRFYALPLMLAALAGCATQGKPPPVISLDESVQAQPLPEPPTPIEVVAVPEVLPMPAQLKPLPEAE
DAKPAPEPADEKVRVSRANAEARVAPTREGYVNAIQVWPFTDGALYQVYAAVGRVTVVSLQPGEELVTVA
AGDTVRWIVGDTSSGSGADLRVNVLVKPIRSGLKTNLVITTSRRTYLLELASTEKTWMASVSWEYPRDRM
LALQRQAQAASAAAPVDSGLSLENLRFRYAISGSNPPWKPLRAFDDGAKVYIQFPAGIAQGELPPLFVIG
AQGDGQLVNYRFRSPYFIVDRLFGAAELRLGGDKGDVVRIERTDGVVGSVGRN
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1679916-1680917 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAGCCTGTCTTTCCGCTTTTACGCTTTGCCGTTGATGCTTGCTGCCCTTGCGGGTTGCGCCACGCAGG
GCAAGCCGCCGCCCGTGATCTCGCTCGATGAGTCAGTGCAGGCCCAGCCGCTGCCTGAGCCGCCGACGCC
GATAGAGGTGGTGGCCGTGCCCGAGGTGCTACCGATGCCGGCGCAATTGAAGCCGCTGCCCGAAGCCGAG
GACGCCAAGCCCGCGCCGGAGCCGGCCGACGAGAAGGTGCGCGTCTCGCGCGCCAATGCCGAGGCCCGCG
TCGCGCCCACGCGCGAGGGCTACGTCAACGCGATTCAGGTGTGGCCCTTCACGGATGGCGCGCTCTATCA
GGTCTATGCGGCCGTGGGCCGCGTGACCGTGGTTTCGCTCCAGCCGGGCGAGGAACTGGTGACGGTGGCC
GCCGGCGATACCGTGCGCTGGATCGTGGGCGACACGTCCAGCGGCAGCGGTGCCGACCTGCGCGTGAACG
TGCTGGTCAAGCCGATCCGCTCGGGCCTCAAGACCAATCTCGTCATCACCACCAGCCGTAGGACGTACCT
GCTGGAGCTGGCTTCGACCGAGAAAACGTGGATGGCGTCGGTGTCCTGGGAATACCCACGCGACCGGATG
CTGGCCTTGCAGCGCCAGGCGCAGGCGGCCAGCGCCGCCGCGCCCGTGGACTCTGGCTTGTCGCTGGAGA
ACCTGCGCTTCCGCTACGCGATCAGCGGCAGCAATCCGCCGTGGAAGCCACTGCGTGCCTTCGACGATGG
CGCGAAGGTCTATATCCAGTTTCCAGCGGGCATCGCCCAGGGCGAGCTGCCGCCGCTGTTCGTCATTGGC
GCCCAGGGCGACGGGCAGTTGGTGAACTACCGCTTCCGCTCGCCGTATTTCATCGTCGATCGCCTGTTCG
GCGCCGCCGAGTTGCGCTTGGGCGGGGACAAGGGCGACGTGGTGCGGATCGAGCGCACGGATGGCGTCGT
GGGCTCGGTCGGGAGGAACTGA
 Primer design