SecReT4
Protein ID: 94310501
T4SS name [ID]Trb [263]
Gene symboltrbI
Locus tagRmet_1559
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]1680920..1682188 [+]
Producttype IV secretion system transmembrane protein
Component typeTrbI
UniProt IDQ1LN34
KEGG IDrme:Rmet_1559
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.6e-58, Aligned region: 226..408
Protein Sequence: 422 a.a.     [Download]
>gi|94310501|ref|YP_583711.1| trbI gene product [Cupriavidus metallidurans CH34]
MSQDDTPDLAAPSAGKVAPEAVALRAQPRPVTRLNRRTLAILVGGLSVAVLGATIWSLQPHRRGAGEQTE
LYNVDRVSKSEGLDGLPADYSKLPPKVPELGPPLPGDLGPAIVNSQQPAVAAYAAPGHDPNDALRKEAEA
AAASSVFFRSGGQAAATVAQAAPGVPGVASTLAAFDPLAAGPASTAAQPADPTAVQNRQDQKEAFLKAGS
TETRNSGNLALPTSPYQVMAGTVIAGALVTGIKSDLPGDVIATVTEPVYDTATGKFLLIPQGSRILGKYN
SQVSYGQSRVQVVWNRVILPDTSSLTLDNLVGTDPAGYAGLEDDVDWHWKRIFAGAVLTTLLGVGAELAA
PENRQDGNRIVIAGRDSAQDSINQVGQEITRRNMNIQPTLTARPGLPVRVIVARDLVLRPYQPMFYQLGG
AR
 
Nucleotide Sequence: 1269 bp     [Download]
>gi|94308945|ref|NC_007973.1|:1680920-1682188 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAGCCAGGACGACACCCCCGACCTTGCCGCGCCTTCGGCGGGCAAGGTGGCGCCCGAGGCGGTGGCGC
TGCGCGCCCAGCCGCGCCCGGTCACGCGCCTGAATCGGCGCACGCTGGCCATCCTCGTCGGCGGCCTGTC
GGTCGCCGTGCTCGGGGCCACGATCTGGTCATTGCAGCCGCACCGGCGTGGCGCGGGCGAGCAGACCGAG
CTTTACAACGTGGATCGTGTCTCGAAGTCCGAAGGGCTGGACGGCCTGCCGGCCGACTACTCGAAGCTGC
CGCCGAAGGTGCCCGAGCTGGGGCCGCCGCTGCCGGGCGACCTCGGCCCGGCCATCGTGAACTCGCAGCA
GCCAGCCGTGGCCGCCTACGCGGCCCCCGGCCACGATCCCAACGACGCCTTGCGCAAGGAAGCGGAGGCC
GCTGCGGCTTCGTCGGTGTTCTTCCGCTCGGGTGGTCAAGCCGCGGCCACGGTGGCGCAGGCAGCGCCGG
GCGTACCTGGCGTGGCAAGCACGCTCGCGGCCTTCGATCCGCTCGCCGCCGGGCCGGCCTCGACGGCGGC
CCAGCCCGCCGACCCGACCGCCGTGCAGAACCGGCAAGACCAGAAAGAGGCGTTCCTGAAAGCCGGTTCT
ACGGAAACCCGTAATTCCGGCAATCTGGCGCTGCCGACGTCGCCGTATCAGGTCATGGCTGGAACGGTGA
TCGCCGGGGCGCTGGTGACGGGCATCAAGTCGGACTTGCCGGGCGACGTGATCGCCACCGTCACGGAGCC
GGTCTATGACACGGCCACGGGCAAGTTCCTGCTGATCCCGCAGGGATCGCGCATCCTGGGCAAATACAAC
AGCCAGGTCAGCTATGGGCAGAGCCGCGTGCAAGTGGTGTGGAACCGCGTCATCCTGCCGGACACGTCAT
CGCTGACGCTCGACAACCTCGTGGGCACTGACCCGGCCGGCTACGCGGGCCTGGAAGACGACGTGGACTG
GCACTGGAAGCGCATCTTTGCCGGTGCGGTGCTGACGACGCTGCTGGGCGTCGGCGCCGAGCTGGCCGCG
CCGGAGAACCGCCAGGACGGCAACCGCATCGTCATCGCCGGGCGCGACAGCGCCCAGGACAGCATCAATC
AGGTCGGGCAAGAGATCACCCGGCGCAACATGAACATCCAGCCGACGTTGACGGCACGGCCGGGCTTGCC
GGTTCGGGTGATCGTGGCGCGCGACCTCGTGTTGCGTCCTTACCAACCCATGTTCTATCAGCTTGGAGGT
GCGCGATGA
 Primer design