SecReT4
Protein ID: 94311269
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2333
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2547127..2547864 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ1LKW6
KEGG IDrme:Rmet_2333
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|94311269|ref|YP_584479.1| unnamed protein product [Cupriavidus metallidurans CH34]
MKPSILLFAVLVASSQWPAWAQQPATTSARNAQSQERPLAARVLDDRVATEWGLQPQEWARYRELMDGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDKPG
AGPSSSPLRGSGRMAVFVKDGCAACGQLVQRLQSSGAEFDLYMVGSRQDDARIRDWAKRAQIDPARVRAG
SITLNHDGGRWLSLGLPGDLPAAVREVNGQWQRQP
 
Nucleotide Sequence: 738 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2547127-2547864 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAAGCCGTCGATCCTCCTTTTCGCGGTCCTGGTGGCGTCGTCGCAATGGCCCGCCTGGGCGCAGCAGC
CCGCAACGACCTCGGCGCGCAACGCACAGAGCCAGGAGCGCCCGCTGGCCGCCCGCGTGCTGGACGACCG
GGTGGCAACCGAATGGGGCTTGCAGCCACAAGAATGGGCACGCTACCGCGAGCTGATGGATGGGCCGCTG
GGTATCTACTCGCCCAACCTGGACCCGCTGTCCGCCCTGGGCATCGAAGCTCGCACGGACGAAGAACGGC
GCCGCTATGCGGAACTGCAGGTGCAGGTGGAAGCGCGCCGCGTCGAGAAGCTGCTCGCCTACCAGCGCGC
CTACGACGAGGCCTGGCAGCGCCTGAATCCGGGGATGCAGCGCGTGAACCTGCCCGACGACAAGCCGGGC
GCCGGCCCATCCAGCAGTCCCTTGCGCGGCAGCGGCCGCATGGCGGTGTTCGTCAAGGACGGCTGCGCAG
CCTGCGGACAGCTCGTGCAGCGCCTGCAATCCTCGGGCGCGGAGTTCGACCTGTACATGGTGGGCAGCCG
CCAGGATGACGCGCGCATCCGCGACTGGGCCAAGCGCGCGCAGATCGACCCGGCGCGCGTGCGCGCCGGC
AGCATCACGCTCAACCACGACGGCGGCCGCTGGCTGTCACTGGGCCTGCCCGGCGATCTGCCCGCCGCCG
TGCGCGAAGTGAACGGCCAATGGCAGCGCCAGCCGTAG
 Primer design