SecReT4
Protein ID: 94311270
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2334
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2547846..2548436 [+]
Productputative lytic transglycosylase, catalytic
Component typeTfc4
UniProt IDQ1LKW5
KEGG IDrme:Rmet_2334
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 196 a.a.     [Download]
>gi|94311270|ref|YP_584480.1| unnamed protein product [Cupriavidus metallidurans CH34]
MAAPAVAMPLRALVLTAGLYAVAALAQEVPPPAYQLAAQRAGIPSTVLYAVALQESGIRRNGRLVPWPWS
LNVAGQSRRFATRADACAGLQQAMRATPHTRIDAGLGQINLGYHKHRFTGACDLLDPYRNLAVAAEILKE
QHTPGEDWLLAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRPAAAVLAARQETSP
 
Nucleotide Sequence: 591 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2547846-2548436 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGCAGCGCCAGCCGTAGCCATGCCCCTGCGCGCACTGGTGCTCACTGCCGGCCTGTATGCCGTTGCCG
CCCTGGCCCAGGAGGTTCCGCCACCGGCTTACCAGCTTGCCGCCCAGCGCGCAGGCATCCCCTCGACCGT
GCTCTACGCCGTGGCCTTGCAGGAGAGCGGCATCCGGCGCAACGGGCGCCTGGTGCCGTGGCCGTGGTCC
CTCAACGTCGCCGGCCAGTCGCGCCGCTTCGCCACGCGCGCCGACGCCTGCGCTGGCCTGCAGCAGGCGA
TGCGCGCCACGCCGCACACGCGCATTGATGCGGGCCTGGGCCAGATCAACCTCGGCTACCACAAGCACCG
CTTTACCGGCGCGTGCGACCTGCTGGATCCGTATCGCAACCTGGCCGTTGCCGCCGAGATCCTGAAGGAG
CAGCACACCCCCGGCGAGGACTGGCTGCTGGCGATCGGCCGCTACCACCGCCCCGCAGGCGGCGAGCCCG
CCGCCCGCTATCGGCGCAGCGTGTCGCGCCACCTTGCCCGCGTGCAGGGCACGCGACCAGCCGCCGCGGT
CCTCGCGGCGCGCCAGGAGACCTCCCCATGA
 Primer design