SecReT4
Protein ID: 94311271
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2335
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2548433..2548981 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDQ1LKW4
KEGG IDrme:Rmet_2335
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.5e-52, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|94311271|ref|YP_584481.1| unnamed protein product [Cupriavidus metallidurans CH34]
MTKPHPAHLAFTGLLMLLSGLPLASRAGEPLIVVEDRGGTSALPYYEALNLQPRANAPARPSIPTPQVPA
TRADEAAMLPVRSAKLTPGTVARRVIEAPGLRPFVVIGDDEASRAWLQRRAAALRERGAVGLVVNVETAQ
GLARLRALVPGVPLAPVAGDDLADRLGLRHYPALITATGIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2548433-2548981 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACGAAACCCCATCCCGCCCATCTCGCGTTCACGGGCCTACTCATGCTGCTGTCAGGCCTGCCGCTGG
CCTCGCGTGCCGGCGAGCCACTGATCGTTGTCGAGGACCGTGGCGGCACGTCGGCATTGCCGTACTACGA
AGCCCTGAATCTCCAGCCGCGCGCCAACGCACCGGCGCGGCCGTCCATCCCGACGCCCCAGGTTCCTGCC
ACACGGGCGGACGAAGCCGCGATGCTGCCGGTGCGCAGCGCCAAGCTCACGCCCGGCACCGTCGCGCGAC
GGGTGATCGAAGCGCCCGGCCTGCGGCCGTTCGTGGTCATCGGCGACGACGAGGCTTCCCGGGCCTGGTT
GCAGCGCCGCGCCGCCGCTTTGCGCGAACGTGGCGCGGTCGGCCTGGTCGTCAACGTCGAGACCGCGCAG
GGCCTGGCGCGGCTGCGCGCCCTGGTGCCGGGCGTGCCGCTCGCGCCCGTGGCCGGCGACGACCTGGCCG
ATCGCCTGGGCCTGCGGCACTACCCGGCGCTGATCACGGCCACCGGCATCGAGCAATGA
 Primer design