SecReT4
Protein ID: 94311273
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2337
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2551172..2551921 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ1LKW2
KEGG IDrme:Rmet_2337
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.8e-70, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|94311273|ref|YP_584483.1| unnamed protein product [Cupriavidus metallidurans CH34]
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQYELGH
LSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARAASHGQSRNFRYYISQVYVWAES
YLIAAAFTTLTFLVRLLVLVLTLPLILTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLAVLP
WVTYLALPIAVHPLVILLPSAALLGMAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2551172-2551921 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAAGGATGCCGCCTCGACCGCGCAGCGGGAGCAGAACCAGCGCCAGGGGCTGATCGTCGGCACCATCA
CCTTGCCGTTCCGGCTGCTCGGGGTGCTCATCGGCTCGCTGCTGTTCTCGATCGTGGTGGAGTGCGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGCTGGCGCCACTCCCAGCAGATGCTGCAGTACGAACTCGGGCAC
CTGTCCAACCACTTCACGCGCAGCGTGGTGGTGCAGGAGCCCGGGCGCACGGCGCACGAGCTGGTGGATA
CCGGGTACGAGTGGGTGTTCGTGCGCTCGGGGTTGCTGGAGCGCATGAGCCAGACCGCCGAGCGCGCCCG
CGCGGCCAGCCACGGGCAGAGCCGCAACTTCCGCTACTACATCAGCCAAGTCTATGTCTGGGCCGAAAGC
TACCTGATCGCTGCGGCCTTCACGACGCTCACCTTCCTGGTGCGCCTGCTGGTCCTGGTACTCACGCTGC
CGCTGATCCTCACTGCAGCATTCGTCGGCCTGATCGACGGCCTGGTGCGACGGGATGTGCGCCGGTTCGG
CGCGGGCCGCGAATCCGGCTTCATCTACCACCGCGCGAAGGCCAGCCTGATGCCGTTGGCCGTGCTGCCT
TGGGTCACCTATCTCGCACTGCCCATAGCGGTGCATCCTCTGGTCATCCTGCTGCCCAGCGCGGCGTTGC
TGGGGATGGCAGTCAGCCTGACCGCAGGCAGCTTCAAGAAGTACTTATGA
 Primer design