SecReT4
Protein ID: 94311281
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2345
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2559404..2559787 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ1LKV4
KEGG IDrme:Rmet_2345
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.2e-30, Aligned region: 29..109
Protein Sequence: 127 a.a.     [Download]
>gi|94311281|ref|YP_584491.1| unnamed protein product [Cupriavidus metallidurans CH34]
MVASIWLRAAHRGVPTFLVTALLLGQSQMALAESPAQRQELVAALRQLDALERTVADSAAHAPIQPGERY
HFDYPRLLADLARVRAGIQFHLTPSRAQPRDPSELAGDYRTERAAEPLPATTAGGKQ
 
Nucleotide Sequence: 384 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2559404-2559787 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGGTGGCTTCGATCTGGCTGCGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCGTGACGGCCCTCCTGC
TGGGTCAGTCCCAGATGGCCTTGGCCGAGTCTCCGGCACAGCGCCAGGAGCTGGTCGCCGCACTGCGCCA
GCTCGACGCGCTGGAGCGCACCGTCGCGGACAGCGCCGCGCATGCCCCCATCCAGCCGGGCGAGCGCTAC
CACTTCGACTACCCGCGGCTGCTGGCTGACCTGGCGCGCGTTCGCGCCGGCATCCAGTTTCACCTGACGC
CATCGCGCGCTCAGCCGCGCGACCCCTCCGAACTGGCCGGCGACTACCGCACCGAGCGGGCGGCCGAGCC
GCTGCCGGCGACGACTGCGGGGGGCAAGCAATGA
 Primer design