SecReT4
Protein ID: 94311284
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2348
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2560406..2560804 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ1LKV1
KEGG IDrme:Rmet_2348
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.7e-48, Aligned region: 10..130
Protein Sequence: 132 a.a.     [Download]
>gi|94311284|ref|YP_584494.1| unnamed protein product [Cupriavidus metallidurans CH34]
MSEQQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGAAGLLVGAPLSWVFRTIAIAPTFVVLG
VALGVFIGGGILRRLKRGRPDTWLYRQLQWRIATGHPLMAGWVGGHVLISRSGFWSTRRSMR
 
Nucleotide Sequence: 399 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2560406-2560804 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGTCCGAGCAGCAGCACGTCCGTGCGGACGGGACGGTCACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTCGTGCGCGGCCTCACCGCCGACGAGCTGTGGATCTGCTGCGGCCTGTCCGGCGCCGCCGGCCT
GCTGGTCGGCGCGCCGCTTTCGTGGGTGTTCCGCACGATCGCCATCGCACCGACGTTCGTTGTCCTGGGC
GTGGCCTTGGGCGTGTTCATCGGCGGCGGCATCCTGCGCCGCCTCAAGCGTGGGCGCCCCGACACCTGGC
TTTATCGGCAGTTGCAGTGGCGCATCGCAACGGGCCATCCGCTGATGGCCGGCTGGGTGGGCGGCCACGT
GCTGATCTCGCGCTCGGGCTTCTGGTCCACCCGCAGGAGCATGCGATGA
 Primer design