SecReT4
Protein ID: 94311285
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2349
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2560801..2561493 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDQ1LKV0
KEGG IDrme:Rmet_2349
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.9e-89, Aligned region: 6..206
Protein Sequence: 230 a.a.     [Download]
>gi|94311285|ref|YP_584495.1| unnamed protein product [Cupriavidus metallidurans CH34]
MSRFKNEIAHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYAF
TFYVFQTLNRWPTNGEEDYSRNLHTLSPYLTPSCQAFLRADYDYRRSTGELRQRVRGIYEIPGRGYGDDP
TARVRTVSDRDWVVTLDITADEYYGAEQVKRALVRYPIKVTRVDVDPARNPFGLALDCYEGAPQRISAPE
PARPASSGLSPQAPQGGNTP
 
Nucleotide Sequence: 693 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2560801-2561493 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAGTCGCTTCAAGAACGAGATCGCCCACCTGCAGGCGCACATCAAGACCTTGCGCCTGGGCGCGGGCG
CGCTGGTCATTGTCGCCCTGGTCATGGGCGGCGGCTGGTGGAGCGCGCCGCGCGACCTGACCATCCACGT
CCCGCCCGACCTGCGCTCTGGCAGTACCCGCAAGTGGTGGGAAGTGCCGCCCGAATCGGTCTATGCGTTC
ACGTTCTACGTGTTCCAGACGCTGAACCGCTGGCCGACCAATGGCGAAGAAGACTACTCGCGCAACCTCC
ACACGCTCTCGCCGTACCTCACCCCGTCCTGCCAGGCCTTCCTTCGCGCGGACTACGACTACCGCCGCTC
CACCGGCGAGCTACGCCAGCGCGTGCGCGGCATCTACGAGATTCCCGGCCGCGGCTATGGCGACGACCCC
ACGGCGCGCGTGCGCACCGTGTCCGATCGCGACTGGGTGGTGACGCTGGACATCACGGCGGACGAGTACT
ACGGCGCCGAGCAGGTCAAGCGCGCCCTGGTGCGTTATCCGATCAAGGTCACGCGGGTGGACGTCGATCC
CGCCCGCAACCCGTTCGGCCTGGCGCTGGACTGCTACGAAGGCGCGCCCCAGCGCATCAGTGCACCGGAG
CCGGCGCGCCCGGCGTCGAGTGGCCTGTCTCCGCAAGCGCCTCAAGGAGGAAACACCCCATGA
 Primer design