SecReT4
Protein ID: 94311286
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2350
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2561490..2562401 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ1LKU9
KEGG IDrme:Rmet_2350
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 5.8e-127, Aligned region: 7..286
Protein Sequence: 303 a.a.     [Download]
>gi|94311286|ref|YP_584496.1| unnamed protein product [Cupriavidus metallidurans CH34]
MKHPVLALLGLLAVAAAPVAQAVEILRWERMPLAVPLKVGQERIVFIDRNVRVGVPAGVGERLRVQSAGG
AVYLRASEPIEPTRLQLQDADTGALILLDIAAEPPKDGEAELEPVRIVEGDSAPGRYGEQADSAEAPARA
QGQAGARTARRETPVPVVLTRFAAQNLYAPLRTVEPLPGVMRVNLPRDLDLDTLMPTLPVRAVALASWRL
EDQWVTAVRLTNTGADWVALDPRVLQGDFLTATFQHEALGPRGTPEDTTVLYLVTGGRGLAQSLLPAIHR
FDPAVHLPQPDGDENAKEARHAQ
 
Nucleotide Sequence: 912 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2561490-2562401 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAAGCATCCTGTACTCGCGCTGCTGGGGCTACTGGCCGTGGCCGCGGCACCCGTCGCCCAGGCGGTGG
AGATCCTGCGTTGGGAACGCATGCCACTGGCAGTGCCGCTGAAGGTCGGTCAGGAACGCATCGTGTTCAT
CGACCGGAACGTGCGCGTGGGCGTGCCCGCGGGCGTGGGCGAACGCCTGCGCGTGCAGAGTGCGGGTGGC
GCGGTGTACCTGCGCGCCAGCGAGCCGATCGAGCCCACGCGGTTGCAACTGCAGGACGCCGACACGGGCG
CGCTGATCCTGCTGGACATCGCAGCCGAACCGCCCAAGGACGGGGAAGCCGAGCTGGAGCCGGTGCGCAT
CGTCGAGGGTGACAGCGCACCGGGACGCTATGGCGAGCAGGCCGACAGTGCCGAGGCCCCGGCACGCGCC
CAGGGCCAGGCAGGTGCGCGGACCGCGCGGCGCGAAACTCCGGTCCCTGTCGTGCTGACGCGCTTCGCCG
CGCAGAACCTCTACGCACCGCTGCGCACCGTCGAGCCGCTTCCGGGCGTCATGCGGGTCAACCTGCCCCG
CGACCTCGACCTGGACACACTGATGCCAACGCTGCCGGTGCGCGCGGTCGCGCTCGCGTCGTGGCGCCTG
GAAGACCAATGGGTGACTGCCGTGCGCCTTACCAACACCGGCGCCGACTGGGTCGCGCTCGACCCGCGCG
TGCTGCAAGGCGATTTCCTCACCGCCACCTTCCAGCACGAGGCGCTGGGCCCGCGCGGCACGCCCGAGGA
CACGACCGTCCTCTACCTGGTCACGGGCGGCCGCGGCCTCGCGCAGTCGCTGCTGCCGGCGATTCACCGC
TTCGACCCTGCCGTGCATCTGCCGCAGCCGGACGGCGACGAGAACGCCAAGGAGGCCCGCCATGCGCAGT
AA
 Primer design