SecReT4
Protein ID: 94311287
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2351
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2562391..2563809 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ1LKU8
KEGG IDrme:Rmet_2351
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 472 a.a.     [Download]
>gi|94311287|ref|YP_584497.1| unnamed protein product [Cupriavidus metallidurans CH34]
MRSNGLLKWLMIPVAILVLFVGIRLFSGGGSTAPPAADNGAQLTPEEMKALGIEGDTPRDTVATLVAQVK
QLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALESERSNLRRDQEQAASARQQTEGLLADLQRRL
DSIGGRGGGHADLPVGLGLQGGDEAGMEGGVRWVEPDDAKPAEGRNGGRGASGGMSFPTSFGPAQSTLET
TAETVANAGARASGVKSAKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFNDGTIRTIPEDREGNQQNNQQRDGLGWISDPHGIPCV
SGERRSNAQQYLGSQALITAAGAGVASLIESDSGRMSYVGSDGSIGTVGITGQEAVGQILAGGVRDMSAW
VNKLYGQAFAAVYVQPGAKVAVHLEKPLAIDFDPEGRKVDHRAGESHALELD
 
Nucleotide Sequence: 1419 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2562391-2563809 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCGCAGTAACGGCCTGCTCAAGTGGCTGATGATCCCTGTCGCCATCCTGGTGCTGTTCGTCGGTATCC
GGCTGTTCTCGGGTGGAGGCAGCACGGCGCCACCCGCGGCGGACAACGGCGCCCAGCTCACGCCCGAGGA
AATGAAGGCGCTGGGCATCGAAGGCGACACCCCGCGCGACACCGTGGCGACGCTCGTTGCCCAAGTGAAG
CAGTTGCGCACCGAGCTTCAGACCGCGCTCTCGGACAACAAGTCGCAGCGTGAAGAGAACCAGCGACTGC
GCCAGCGCGAGAACTCCATCGACCAGCGCATCAACTCGGCGCTCGAATCCGAGCGGTCCAACCTGCGCCG
CGACCAGGAGCAGGCGGCCAGCGCGCGCCAGCAGACCGAAGGGCTGCTCGCCGACCTGCAGCGGCGCCTG
GACAGCATCGGCGGGCGCGGCGGCGGCCATGCGGACCTGCCCGTGGGCCTGGGGCTGCAGGGCGGCGACG
AGGCCGGCATGGAGGGCGGCGTGCGGTGGGTCGAGCCGGACGACGCAAAGCCCGCCGAGGGGCGCAACGG
CGGTCGTGGCGCGAGCGGCGGAATGAGCTTCCCCACGAGCTTCGGCCCGGCGCAGAGCACGCTCGAAACC
ACCGCGGAAACCGTGGCCAACGCGGGCGCCCGCGCCTCTGGGGTCAAGAGTGCCAAGCCGGTCTATACCG
TGCCGACCAACTCCACGCTCATGGGTTCGGTCGCCATGACCGCGCTGATCGGCCGCGTGCCGATCGACGG
CACGGTCAACGATCCCTATCCGTTCAAAGTCCTGGTCGGGCCGGACAACCTGACCGCCAATGGCATCGAC
ATTCCCGACGTGGCCGGCGCCGTGTTCAGCGGCACCGCATCGGGCGACTGGACGCTTTCGTGCGTGCGCG
GCCAGGTGCGCAGCATCACGTTCGTCTTCAACGACGGCACGATCCGCACGATCCCCGAAGACCGCGAGGG
CAACCAGCAGAACAACCAGCAACGCGACGGCTTGGGCTGGATCAGCGACCCGCACGGCATCCCCTGCGTC
AGCGGCGAGCGGCGCAGCAACGCCCAGCAGTACCTCGGCTCGCAGGCCCTGATCACCGCGGCCGGTGCCG
GCGTGGCCTCGCTCATCGAGAGCGACAGCGGCCGCATGTCCTATGTCGGCTCGGACGGCTCCATCGGCAC
CGTGGGCATCACCGGCCAGGAAGCGGTCGGCCAGATTCTCGCGGGCGGTGTCCGGGACATGTCGGCCTGG
GTCAACAAGCTCTACGGCCAGGCGTTCGCCGCCGTCTATGTGCAGCCCGGCGCCAAGGTCGCCGTCCACC
TCGAAAAACCGCTCGCCATCGACTTCGATCCCGAAGGCCGCAAGGTCGATCACCGCGCAGGAGAAAGCCA
TGCTCTCGAACTCGATTAA
 Primer design