SecReT4
Protein ID: 94311288
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2352
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2563790..2564230 [+]
Productputative secreted protein
Component typeTfc15
UniProt IDQ1LKU7
KEGG IDrme:Rmet_2352
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 146 a.a.     [Download]
>gi|94311288|ref|YP_584498.1| unnamed protein product [Cupriavidus metallidurans CH34]
MLSNSIKGLVLALAVAVLGGCATSKEKLLTHGDRTMMDIWQQEAGDGGGAAGRNAGRQLLDARQSLRRPL
TDADVQAAPVEQMRYTRTARNEVHRQFQRLPNPDLVMYVYPHLAGTDPVPVPGYTTVFPLYQRIQYAMPG
ERVEDY
 
Nucleotide Sequence: 441 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2563790-2564230 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCTCTCGAACTCGATTAAGGGCCTGGTGCTGGCCCTCGCCGTCGCGGTGCTCGGCGGCTGCGCCACCA
GCAAGGAAAAGCTGCTGACCCACGGTGACCGCACGATGATGGACATCTGGCAGCAGGAGGCCGGCGACGG
CGGTGGCGCAGCCGGACGGAACGCCGGCCGCCAGCTGCTCGATGCGCGCCAGAGCCTGCGTCGGCCCCTG
ACCGACGCCGACGTGCAGGCCGCACCTGTCGAGCAGATGCGCTACACGCGCACCGCGCGCAATGAGGTCC
ACCGCCAGTTCCAGCGCCTGCCCAATCCCGATCTCGTGATGTACGTGTACCCGCATCTGGCCGGCACCGA
TCCCGTGCCGGTGCCCGGCTACACGACCGTCTTCCCGCTCTACCAGCGCATCCAGTACGCGATGCCGGGC
GAGCGCGTGGAGGACTACTGA
 Primer design