SecReT4
Protein ID: 94311289
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2353
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2564230..2567121 [+]
Producttype IV secretory pathway, VirB4 components
Component typeTfc16
UniProt IDQ1LKU6
KEGG IDrme:Rmet_2353
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.3e-65, Aligned region: 64..343
AAA_10 [PF12846], Evalue: 1.2e-44, Aligned region: 537..875
Protein Sequence: 963 a.a.     [Download]
>gi|94311289|ref|YP_584499.1| unnamed protein product [Cupriavidus metallidurans CH34]
MRWKLPWPKLAGAGSSSPASDEQPDSWQRHVEALRQAGIPEPGSAVHGRKPATVADEQALYDVAPSFVEL
LPWVEFLPGSKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDENPWVLQLYAQ
DEPSFDQYMQTLRDYVQPRARGSAFTEFYLRFFGHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYR
RASGQGQANRRGQTPEQMLGIVCDRLCGGLANAGIQARRMVAADVHDWLLRWFNPRPTLLGPGVEDRERF
YALARYPDSTEESEAGEIELASGRDFSQRLFFGQPRSDVAQGAWYFDGMPHRVLITDRLRMPPGTGHLTG
ETRKGDAINTLFDQMPEDTLMCLTMVATPQDVLESDLNHLAKKAVGETLASEQTLKDVHEARSLIGSAHK
LYRGTLAFYLRGRDEAELDRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPGKDRRRWYTQL
MFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQ
VTAIYRPRLFIVEAGNSFGLFSDFARRLGLTVNRVKLAPGSGISLAPFADARRLIETPSDVQTLDADALD
EDLPPDASAMEADEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIRQCILDAAEHCVAEKRTVLTR
DVRNALRTRGQDPTLPEMRRVRLLEMADAMDMFCQGTDGEMFDRDGTPWPEADITLVDLATYAREGYNAQ
LSIAYISLISTVNNIAERDQYLGRPIINVTDEGHVITKNPLLAPYTVKITKMWRKLGAWYWLATQNIDDL
PRAAEPMLNMIEWWICLSMPPDEVEKIARFRELSQAQKALMLSARKEAGKFTEGVILSKSMEVLFRAVPP
SLYLALAQTEPEEKAERYQLMQQHGVSELDAAFKVAEKIDRARGIESPALDLP
 
Nucleotide Sequence: 2892 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2564230-2567121 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCGGTGGAAACTCCCATGGCCGAAGCTGGCCGGCGCCGGCTCCAGTAGCCCGGCTAGCGATGAGCAGC
CGGACAGCTGGCAGCGCCACGTCGAGGCCTTGCGCCAGGCCGGCATCCCCGAACCCGGTTCGGCAGTCCA
CGGCCGCAAGCCAGCGACCGTGGCCGACGAGCAGGCGCTGTACGACGTTGCGCCGTCCTTCGTGGAACTG
CTGCCCTGGGTGGAGTTCTTGCCCGGGTCGAAATCGATGCTCCTGGAGGATGGCCAATCGGTGGCGGCGT
TCTACGAACTGGTGCCGCTGGGCACCGAAGGCCGGGAACCCGGCTGGCTCGCGCATGCCCGCGACGCCCT
GGAAAACGCGCTTCAGGACAGTTTCGATGAACTGGACGAGAACCCGTGGGTGCTCCAGCTCTATGCCCAG
GACGAACCGAGCTTCGACCAGTACATGCAGACCTTGCGCGATTACGTGCAGCCACGTGCGCGCGGCTCGG
CGTTCACCGAGTTCTACTTGCGCTTCTTCGGCCACCACCTGCGCGCTGTGGCCAAGCCCGGCGGCCTGTT
CGAGGACACGGTGGTTACGCGGCTGCGCTGGCGCGGGCAGACGCGGCGTGTGCGCATGGTGGTGTACCGC
CGCGCGAGCGGACAGGGACAGGCAAACCGCCGCGGCCAGACACCCGAGCAGATGCTGGGCATCGTCTGCG
ACCGCCTATGCGGCGGCCTGGCGAACGCCGGCATCCAGGCCCGGCGCATGGTTGCAGCGGACGTTCACGA
CTGGCTGCTGCGATGGTTCAACCCGCGCCCCACGCTGCTCGGCCCTGGGGTGGAGGACCGGGAGCGCTTC
TACGCGTTGGCGCGCTATCCGGACAGTACCGAGGAAAGCGAGGCCGGCGAGATCGAGTTGGCGAGCGGGC
GGGATTTCAGCCAGCGGCTGTTCTTTGGGCAGCCGCGCTCGGACGTGGCGCAAGGGGCCTGGTACTTCGA
CGGCATGCCGCACCGCGTGCTGATCACCGACCGGCTGCGCATGCCGCCCGGCACCGGGCACCTGACCGGC
GAGACCCGCAAGGGAGACGCGATCAACACGCTATTCGATCAGATGCCCGAGGACACCTTGATGTGTCTCA
CCATGGTGGCCACGCCGCAGGACGTCCTCGAATCGGACCTCAACCATCTGGCGAAGAAAGCTGTGGGCGA
GACGCTGGCGTCGGAGCAGACGCTCAAGGACGTGCATGAAGCCCGCTCCCTGATCGGCAGCGCGCACAAG
CTCTACCGGGGCACTCTGGCGTTCTACCTACGCGGGCGCGACGAGGCGGAACTGGATCGGCGCGGCCTGG
ACCTCGCGAACGTGATGCTCAACGCCGGCCTGCAGCCGGTGCGCGAGGACGACGAGGTGGCGCCGCTCAA
CAGCTACCTGCGCTGGCTGCCGTGCTGCTACAACCCCGGCAAGGACCGGCGCCGGTGGTACACGCAACTG
ATGTTCGCCCAGCACGCGGCGAACCTGTCGCCGGTGTGGGGCCGCGCCCAGGGCACGGGGCACCCCGGCA
TCACGATGTTCAATCGCGGAGGCGGCCCGATTACGTTTGACCCCTTGAACAGGTTGGATCGGCAGATGAA
TGCCCATCTGTTCCTGTTCGGTCCCACGGGCTCGGGCAAGAGCGCCACGCTCAACAACCTGCTGAACCAG
GTCACCGCGATCTATCGGCCGCGCCTCTTCATCGTGGAAGCCGGCAACAGCTTCGGCTTGTTCAGCGACT
TCGCCAGGCGCCTGGGGCTGACCGTGAACCGGGTCAAGCTGGCACCCGGCTCGGGCATCAGCCTGGCGCC
GTTCGCCGACGCACGCCGGCTGATCGAAACGCCCAGCGACGTGCAGACGCTCGATGCCGATGCACTGGAC
GAAGACCTGCCACCGGATGCCTCGGCCATGGAGGCGGACGAGCAGCGCGACGTGCTGGGCGAGCTGGAGA
TCACGGCACGGCTGATGATCACGGGCGGCGAAGACAAGGAAGAAGCGCGGATGACGCGGGCCGACCGCTC
GCTGATCCGCCAGTGCATCCTCGACGCGGCCGAACATTGCGTGGCAGAGAAGCGCACTGTGCTCACGCGC
GATGTGCGCAATGCGCTGCGCACCCGCGGCCAGGACCCGACGTTGCCCGAGATGCGGCGCGTGCGGCTGC
TGGAGATGGCGGACGCGATGGACATGTTCTGCCAAGGCACGGACGGCGAGATGTTCGACCGCGACGGCAC
GCCGTGGCCCGAGGCCGACATCACGCTGGTCGATCTGGCGACCTACGCCCGCGAGGGCTACAACGCGCAG
CTCTCGATCGCGTACATCAGCCTCATCAGCACGGTGAACAACATCGCGGAGCGTGACCAGTATCTCGGCC
GCCCGATCATCAACGTGACCGACGAAGGCCACGTGATCACCAAGAACCCGCTGCTCGCGCCGTATACCGT
GAAAATTACAAAAATGTGGCGCAAGCTGGGGGCCTGGTACTGGCTAGCTACACAAAATATTGACGACCTA
CCGCGCGCCGCGGAGCCGATGCTCAACATGATCGAGTGGTGGATCTGCCTGTCGATGCCCCCCGATGAAG
TGGAGAAGATCGCGCGGTTCCGCGAACTGAGCCAAGCGCAGAAAGCGCTGATGCTCTCGGCACGCAAGGA
AGCGGGCAAGTTCACCGAGGGCGTCATCCTCTCCAAGAGCATGGAGGTGCTCTTCCGCGCCGTGCCGCCG
AGCCTGTATCTCGCGCTCGCGCAGACCGAACCCGAAGAGAAGGCCGAGCGCTACCAGCTCATGCAGCAGC
ACGGCGTCAGCGAGTTGGATGCCGCCTTCAAGGTGGCCGAGAAGATCGACCGGGCACGCGGCATCGAGTC
GCCGGCCCTGGACCTGCCCTGA
 Primer design