SecReT4
Protein ID: 94311292
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2356
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2568745..2569191 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDQ1LKU3
KEGG IDrme:Rmet_2356
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.5e-40, Aligned region: 35..146
Protein Sequence: 148 a.a.     [Download]
>gi|94311292|ref|YP_584502.1| unnamed protein product [Cupriavidus metallidurans CH34]
MPGAFTRFAPGWRTLGLAIVLPASFAAFSPAAFAADVVVVTDSRHPVKTMGGERLIELDRASGLEAELSA
DLPADPERAAAIVRQRLNQGGTDLQRRIGTAYQGITDAWSLGVTTIPAVVVDQRYVVYGEPDVARAVSCI
EQHRRRQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2568745-2569191 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGCCAGGAGCTTTTACCCGGTTCGCACCAGGCTGGCGAACCCTTGGCCTGGCCATCGTGCTGCCGGCGT
CGTTCGCGGCATTCAGCCCGGCCGCGTTCGCCGCCGACGTGGTGGTCGTCACCGACAGCCGCCACCCGGT
CAAGACCATGGGCGGCGAGCGGCTGATCGAGCTGGACCGGGCATCCGGGCTCGAAGCAGAGCTTTCCGCA
GATCTGCCAGCCGACCCCGAGCGCGCAGCAGCCATCGTCCGGCAACGCCTGAACCAAGGCGGCACCGACC
TTCAGCGCCGCATTGGCACCGCCTACCAGGGCATCACCGACGCATGGAGTTTGGGTGTCACGACCATCCC
GGCCGTCGTGGTGGACCAACGCTATGTGGTCTATGGCGAGCCTGACGTGGCCCGGGCCGTGTCCTGCATC
GAGCAGCACCGGAGGAGGCAACCGTGA
 Primer design