SecReT4
Protein ID: 94311293
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2357
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2569188..2570138 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDQ1LKU2
KEGG IDrme:Rmet_2357
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.4e-93, Aligned region: 34..304
Protein Sequence: 316 a.a.     [Download]
>gi|94311293|ref|YP_584503.1| unnamed protein product [Cupriavidus metallidurans CH34]
MTYRPFDLLRRLRVAVASLLLVSATGSYALNTVTIVSSVMSPDCLEYRVVGICYWLYCTYGGCSVRTSTK
VRHYVPDAVVSSYSNTGENPWVEVRAMSMPNASAQAGGDGTTNEDHENNLAKFKNADVIGHPGGEVFNQF
ASSSGYFCQGAGTAFMPYLLSTLDTLAWRYNVPEMAYPEALIPGRREVGARTTMNLWGNVYPRGGFLHQT
DDHKSGAVVAQRAGDVVTRRGQLHVYQPLLANARDGYWPAGALMEGDASTGKWQELTPRLSNTCVVFPHS
GTLTQAQQGDYAWALWRPYACCERRGQVFLGSVDFL
 
Nucleotide Sequence: 951 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2569188-2570138 Cupriavidus metallidurans CH34 chromosome, complete genome
GTGACCTATCGCCCATTCGACCTGCTGCGCCGCCTGCGCGTCGCCGTGGCCTCGCTGCTGCTGGTCAGCG
CCACGGGCAGCTACGCCCTGAACACCGTCACCATCGTGTCCTCCGTCATGTCGCCGGACTGCCTGGAGTA
CCGGGTGGTGGGCATCTGCTACTGGCTGTATTGCACCTATGGCGGCTGCTCGGTGCGCACGTCCACCAAG
GTCCGGCACTACGTCCCCGATGCGGTCGTCTCCAGCTACAGCAACACCGGAGAGAACCCCTGGGTCGAAG
TGCGAGCGATGAGCATGCCGAACGCCTCGGCCCAGGCAGGCGGCGACGGCACCACCAACGAAGACCACGA
AAACAACCTCGCCAAATTCAAGAACGCCGATGTCATCGGCCATCCCGGCGGCGAGGTGTTCAACCAGTTC
GCCTCGTCCTCGGGCTATTTTTGCCAAGGCGCGGGAACGGCCTTCATGCCGTATCTGCTCAGCACCTTGG
ACACGCTGGCCTGGCGCTACAACGTGCCCGAGATGGCCTACCCGGAGGCGCTGATCCCGGGCCGGCGCGA
GGTCGGTGCGCGCACCACGATGAACCTCTGGGGCAATGTCTATCCGCGCGGCGGCTTCCTGCACCAGACC
GACGACCACAAATCCGGGGCGGTCGTGGCTCAGCGCGCCGGTGACGTCGTCACGCGGCGCGGGCAGTTGC
ACGTGTACCAGCCGCTGCTCGCCAACGCGCGTGATGGCTACTGGCCGGCCGGCGCGCTGATGGAAGGTGA
TGCCTCGACCGGCAAGTGGCAGGAACTGACGCCGCGCCTGTCGAACACCTGCGTGGTGTTCCCCCACAGC
GGCACGCTGACCCAAGCCCAGCAAGGCGACTACGCGTGGGCGCTGTGGCGTCCGTATGCGTGCTGCGAAC
GCCGGGGCCAGGTGTTCCTCGGCAGCGTCGATTTCCTCTGA
 Primer design