SecReT4
Protein ID: 94311294
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2358
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2570148..2571542 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDQ1LKU1
KEGG IDrme:Rmet_2358
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|94311294|ref|YP_584504.1| unnamed protein product [Cupriavidus metallidurans CH34]
MKRPEPKNLSTKACRLLRPTALAGTLALVCGLAWAQVGYQNSGPVIGDDVMYSIGGGSAVSMGRAAGMRS
IGVGVGWNSNLICGDMSIQTTLRNQLNGITNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAEGMALRDAVGSNDAVSAVEQAETRRGNDGVPWVG
GSNAGGAGQSAIRVVGDVTRAGYNLVNGRGVTDTSSIASASCASLSCQTWTSPQQATEWATRVLGEQVQR
TCDSCTKTETVPGVGLTPLIQEEYEAKLEVLQELVSGTRTTTFENLREAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVKAVNHESDTLDREIRNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGARP
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2570148-2571542 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGAAGCGTCCTGAACCGAAGAACCTGTCCACCAAGGCGTGCCGCCTGCTGCGCCCGACGGCACTGGCCG
GCACGCTCGCCCTGGTCTGCGGCCTGGCGTGGGCACAGGTCGGATACCAGAACAGCGGCCCCGTCATTGG
CGATGACGTCATGTACTCGATCGGCGGCGGCAGCGCGGTGTCCATGGGCCGCGCGGCCGGCATGCGCTCC
ATCGGGGTCGGTGTGGGGTGGAACAGCAACCTGATCTGCGGCGACATGAGCATCCAGACCACGCTGCGCA
ATCAGCTCAACGGCATCACGAACGGCTTTCAGCAGATCATGAGCAACGTAATCCAGAGCGCCACCAGCGC
GGTAGCGTCCCTGCCGGCGCTGATCATTCAGCGCGCCGATCCGGGCCTGTACAACCTGCTGACCAACGGC
GTGCTGCAGGCGCGGCTGGACTTCGACCGCTCCAAGCTGACGTGCCGCGCCATGGCGGAGAAGATGGCCG
AGACAGCGGGTGGCCAGCTTGGCTGGAGCCAGATGGCCGAAGGCATGGCCTTGCGTGACGCGGTTGGCAG
CAACGATGCCGTGTCGGCCGTCGAGCAGGCCGAGACGCGCCGCGGCAACGACGGCGTGCCCTGGGTGGGT
GGCAGCAATGCTGGTGGCGCAGGCCAGTCCGCCATCCGGGTGGTCGGCGACGTCACCCGCGCGGGCTACA
ACCTGGTCAACGGTCGTGGCGTGACGGACACATCCTCCATCGCGTCCGCCAGTTGTGCGAGCCTGTCCTG
CCAGACCTGGACGTCGCCGCAGCAGGCGACCGAATGGGCCACGCGGGTCCTCGGAGAGCAGGTGCAGCGC
ACCTGCGACTCCTGCACCAAGACCGAGACGGTGCCCGGCGTCGGGCTGACGCCGCTGATCCAGGAAGAGT
ACGAGGCGAAGCTGGAGGTCCTTCAGGAGCTGGTTTCCGGCACGCGCACTACCACCTTTGAGAACCTGCG
CGAGGCTGGCAGCACGTCGCTGCCAATCACGCGTGGCGTGATCGAGGCGCTGCGCGACGAGCCGGACCAG
GACCTTCTGGCGCGGCGCCTCGCGTCGGAGGTGGCGCTGTCGTCGGTGCTGGAAAAAGCGCTGCTGCTCC
AGCGCACGCTGCTCACGGGCAAGAAGGAGCCCAACGTCGCAGCCAACGAACTCGCGGTCAAGGCCGTGAA
CCACGAGAGCGACACGCTCGACCGGGAGATCCGCAACCTGAAGACGGAGCTGGAGCTTCGGCGCGAGCTG
GCAAACAACTCACCGATGGCCATCATCCAGCGGCACGGTACGCGCGCGGCAGGCTCGCGCGGCATCTACG
AGGGTGATCCGGTACCCGACCGCCTCGACCAGTTGCAGAAGGGCAATCCAGGAGCCAGGCCATGA
 Primer design