SecReT4
Protein ID: 94311296
T4SS name [ID]Tfc [705]
Gene symbol-
Locus tagRmet_2360
StrainCupriavidus metallidurans CH34
Repliconchromosome [GenBank: NC_007973] [Browse all T4SS(s) in this replicon]
Location [Strand]2571911..2573458 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ1LKT9
KEGG IDrme:Rmet_2360
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1e-126, Aligned region: 10..491
Protein Sequence: 515 a.a.     [Download]
>gi|94311296|ref|YP_584506.1| unnamed protein product [Cupriavidus metallidurans CH34]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIIVQEWLKARAEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLNTIQYDSSRSAQCQVSVPQPSNTGWSQSFSTINNQSAKVPVWWAFMHALS
RAVTGASVAAIPCGTDLRQMRMEIDATRIDDPVLAQEVADFSRDCYGAARAKLFMQRPQLDEQQLHDVTW
IGSRFFTDTNGYYDTYRSSTPREDWPYDSTRDAGLAQVASGGGYPTCRQWWADGSNGLRARLLGQVDPSL
LNRLAGWAGFLSRAEVDDSVIRAIASPRQQKLNQGSVYTDYGGQIEMTDPNIITRAAADVGLAVGSLGYF
PSMDAMRQALPMVLALLKMALVVCIPVVLMVSTYNLKTLVTVSVVQFALFFVDFWFQLARWIDSTILDAL
YGWGWGWNRPHTNFDPVMGLNNAFGDMLLNFVMATMFIVLPLFWVTALGWAGYAVGGMLQGLAAGTAGAK
AAGGKAADMAFGGAMKWASTPSKRK
 
Nucleotide Sequence: 1548 bp     [Download]
>gi|94308945|ref|NC_007973.1|:2571911-2573458 Cupriavidus metallidurans CH34 chromosome, complete genome
ATGACTCTGTTCACGACCGACTACCTGGAGTATTACCTTACGCTGGTGTCCTGGATCGTCAACAACGGCA
TCTGGGCCGTGCTGGTATCCAGCGGCGTCTTCGCGCTGCCTTTCGTGGCGATCATCGTGCAGGAGTGGTT
GAAGGCCCGTGCAGAAGGCGCCGACGAGGGCAATAAAGGCGTGCTGAGCGCCGCCCGCATCGAGAACCGG
GTCTTCGTCGCCATCGTGGTGGTGATGTTCGCGGGCATCCCGTTCATCGACGTGGACCTCAACACCATCC
AGTACGACAGCTCGCGCTCGGCGCAATGCCAGGTCAGTGTGCCGCAGCCCTCGAATACCGGCTGGTCGCA
ATCTTTCAGCACCATCAACAACCAGTCGGCGAAGGTGCCGGTGTGGTGGGCGTTCATGCACGCGCTCTCG
CGCGCCGTCACGGGCGCTTCAGTGGCAGCGATCCCGTGCGGCACGGACCTGCGGCAGATGCGCATGGAGA
TCGACGCGACTCGCATTGACGACCCAGTGTTGGCTCAGGAAGTAGCGGATTTCTCGCGGGATTGCTATGG
GGCTGCGCGGGCGAAATTGTTCATGCAGCGGCCTCAACTCGATGAGCAGCAGCTGCACGACGTAACCTGG
ATCGGCTCACGCTTCTTCACGGACACGAACGGCTACTACGACACATACCGTTCCAGCACCCCGCGCGAGG
ACTGGCCCTATGACAGCACGCGCGACGCAGGGCTTGCGCAGGTGGCCAGCGGCGGCGGCTATCCGACCTG
CAGGCAATGGTGGGCCGATGGCAGCAATGGACTGCGGGCACGCTTGCTGGGTCAGGTGGACCCGAGCCTG
CTCAATCGCCTGGCGGGCTGGGCTGGCTTCCTGAGCCGTGCCGAGGTGGACGATTCGGTGATCCGCGCGA
TCGCGTCACCGCGACAGCAGAAGCTGAACCAAGGCAGCGTCTATACGGACTACGGTGGCCAGATCGAAAT
GACCGACCCAAACATCATCACCCGGGCGGCGGCCGACGTAGGACTGGCGGTAGGCTCGCTGGGCTACTTC
CCCTCCATGGATGCAATGCGCCAGGCTCTTCCGATGGTGCTGGCGCTCTTGAAGATGGCGCTGGTTGTCT
GCATTCCGGTGGTGCTCATGGTTAGCACCTACAACCTGAAAACACTCGTGACGGTCAGCGTGGTGCAGTT
TGCGCTGTTCTTCGTGGATTTCTGGTTCCAACTCGCGCGCTGGATCGACAGCACCATTCTGGACGCGCTC
TACGGATGGGGCTGGGGATGGAACCGGCCGCATACGAATTTCGATCCGGTCATGGGCCTCAACAATGCCT
TCGGAGACATGCTGTTGAATTTCGTCATGGCGACGATGTTCATCGTGCTGCCCTTGTTCTGGGTAACCGC
CTTGGGATGGGCGGGCTACGCCGTGGGGGGCATGTTGCAAGGGCTTGCTGCTGGTACGGCAGGCGCCAAA
GCGGCCGGCGGCAAAGCCGCCGACATGGCCTTTGGCGGCGCTATGAAGTGGGCATCGACACCCAGCAAGA
GGAAGTAG
 Primer design