SecReT4
Protein ID: 9507505
T4SS name [ID]Tra_I [162]
Gene symboltraU
Locus tagColIb-P9_p066
StrainPlasmid ColIb-P9
Repliconplasmid ColIb-P9 [GenBank: NC_002122] [Browse all T4SS(s) in this replicon]
Location [Strand]55322..58366 [-]
Producthypothetical protein
Component typeTraU_I
UniProt IDQ9Z4B7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.8e-46, Aligned region: 502..898
Protein Sequence: 1014 a.a.     [Download]
>gi|9507505|ref|NP_052512.1| traU [Shigella sonnei]
MNINRLIFTIEDCLNTLSRFSVASSFVEYCDLRTVIGLDRQDRERRPWLNSPYIAATKRGEYLSVFEVSG
AFREMDEASDQTGPGSLESLITSMSDSLNTAYKNSGHKISFVFERDPDMGKEEIEDMVAPQKRSLANTGI
QLQDVVDEKVTTLSPWLVRERCWLAIWSGPDLISNSDRTAHDELVRRLAERVPKARFAQSPWQWALSALK
IRHEAFLDNVEQALRHSSDGLIIRLLDIHEVGREIRRQTERHSTPRNWQPHLPEDAQPAGYRWTDDESVL
HAPSLHLQLFNTQVTTQGNLVQAGGLWHGMVSITLPPQNLQTFNELVRAVPRAVPWRIRMDLMPGGMKAL
NLKKTLLTYSSFISAVRPMYESVMTLAATDEKEPVCIMTIMASTWGKTREICTRNQAILKSAIEGWGVCG
TTTTFGDPRRAWVNTILAASGGSGPVPLYPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLAS
SQQNKHTELAPGDPGLGKSVLINTLSEIQISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVG
IILSNDPEYTRNLFDVMYGAKKPITPEKNFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGE
NNPRLYRASTEELVDSALQDSGLYEKHDAAWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSM
LGHTSLRDVFGTVQRDGSNELLLDYIRRALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAG
RLKTGIMYLLAGQIAGGDFTLPQYRDEVLKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWE
NLDTQEREQRKFAIRTVLSTQYLRDYPESVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEG
PAPDGSGVPVLGVFRVKSGTLARILKFTVGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRG
SATSLIEHRAGQHNSDNVIEELASELIRKQGYNL
 
Nucleotide Sequence: 3045 bp     [Download]
>gi|9507440|ref|NC_002122.1|:c58366-55322 Shigella sonnei plasmid P9 DNA, complete sequence
ATGAACATAAACCGTTTAATCTTCACTATCGAAGACTGTCTGAACACGCTATCCCGTTTCTCTGTCGCAA
GCAGTTTTGTTGAGTATTGCGATTTACGTACTGTAATTGGTCTGGACAGACAGGATCGTGAACGTCGCCC
ATGGCTGAATTCGCCCTATATTGCAGCCACAAAGCGTGGAGAATATCTCTCTGTCTTTGAAGTCAGCGGT
GCTTTCAGGGAAATGGATGAAGCATCCGACCAGACTGGCCCAGGTTCACTGGAATCGCTGATCACCAGCA
TGAGTGACAGCCTGAATACGGCATATAAAAACAGCGGTCATAAAATCAGCTTCGTTTTTGAGCGTGATCC
TGACATGGGGAAAGAAGAAATCGAAGACATGGTCGCCCCACAAAAGCGCTCACTGGCTAATACAGGTATC
CAGTTACAGGATGTGGTCGATGAGAAAGTCACAACACTGTCCCCATGGCTGGTCCGGGAGCGTTGCTGGC
TGGCGATCTGGAGTGGACCCGACCTTATCAGCAACAGCGATCGCACCGCCCATGATGAGCTTGTCAGAAG
ACTGGCTGAACGGGTACCGAAAGCACGCTTTGCCCAGTCCCCCTGGCAGTGGGCCTTATCTGCACTGAAA
ATCCGCCACGAAGCTTTTCTTGATAATGTGGAACAGGCACTGAGACATTCATCTGATGGCCTGATTATCC
GGCTACTGGATATACACGAGGTCGGGCGTGAAATACGTCGTCAGACAGAACGGCACAGCACACCGCGTAA
CTGGCAACCCCACCTGCCTGAAGATGCCCAGCCAGCGGGATATCGCTGGACTGACGATGAATCCGTACTA
CATGCTCCTTCATTGCATTTGCAGTTATTCAACACTCAGGTGACCACACAGGGCAACCTGGTTCAGGCGG
GCGGACTCTGGCACGGAATGGTATCGATTACTTTACCTCCGCAAAATCTGCAGACGTTTAACGAACTGGT
CCGTGCCGTCCCCCGCGCAGTCCCCTGGCGCATCAGAATGGATCTGATGCCCGGCGGGATGAAGGCTCTT
AATCTGAAGAAAACGCTTCTGACTTACAGCAGCTTCATTTCTGCCGTTCGTCCAATGTATGAATCCGTTA
TGACCCTGGCGGCAACGGATGAAAAAGAACCTGTCTGCATAATGACCATCATGGCCTCCACGTGGGGAAA
AACACGTGAAATATGCACACGAAACCAGGCCATTCTGAAATCGGCCATTGAAGGCTGGGGCGTATGTGGC
ACCACGACAACATTTGGCGATCCCCGACGCGCCTGGGTGAATACCATTCTCGCGGCATCCGGAGGCTCCG
GCCCGGTTCCCCTGTATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCGCTTAACAGGGCAGGCTCTGT
CTGGCGAGGTAAAGGGAATCTTATGTTACATACAGAAGACGGTTCCGCATTTGAGGTTGGTCTGGCGTCA
TCCCAACAAAATAAACATACAGAACTGGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATA
CGTTGTCGGAAATACAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAGGGATA
CAGTGCTCAGGGACTGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGT
ATTATTCTGAGCAATGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTA
TTACGCCGGAAAAGAATTTCATGTCATCTGTGCTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACC
CTGTAACCCCGGAGACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAA
AATAATCCGCGACTTTATCGCGCCTCAACGGAAGAACTGGTGGATTCAGCACTGCAGGACTCGGGACTGT
ATGAAAAACATGATGCAGCCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGC
CGGGTATATCATGGCGGCTCAGCGGGCACATTATCAGGCAATGCCCCAGCTTCCCGAAGTGTCCTCGATG
CTGGGCCATACCAGTCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAACTTCTGCTGG
ACTACATCCGCCGCGCTCTCGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTAT
GATCAACCCGGAAACCCGGGTCATCGCTGTCGATCTGAATAATGTTGCCGGTGACAAAACGCCTGCAGGC
AGGCTTAAAACCGGCATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAAT
ACAGGGATGAAGTGTTAAAGCAGCTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACT
TGATCAGGAGGTTAAGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGCATTGACTTCATCTGGGAA
AATCTGGATACCCAGGAGCGTGAGCAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACGCAGTATCTGA
GGGACTACCCGGAAAGCGTTCTTAAGTCAGCAAATACTCTCTGGTTACTGCGCTACAAACCCGAAGATAT
CCCCGTACTGAGGGATAACTTCAACGTGCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGC
CCGGCACCAGATGGTAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAA
TACTCAAATTTACCGTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCGCCAAAAGACAGTGCCCTGCG
TAAAACGCTGACAAATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGT
TCTGCAACGTCATTAATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGAACTGGCCT
CGGAGCTCATCCGAAAACAGGGATACAATCTCTGA
 Primer design