SecReT4
Protein ID: 9507513
T4SS name [ID]Tra_I [162]
Gene symboltraM
Locus tagColIb-P9_p074
StrainPlasmid ColIb-P9
Repliconplasmid ColIb-P9 [GenBank: NC_002122] [Browse all T4SS(s) in this replicon]
Location [Strand]63464..64156 [-]
Producthypothetical protein
Component typeTraM_I
UniProt IDQ9Z4A9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 3.4e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|9507513|ref|NP_052520.1| traM [Shigella sonnei]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTSQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFVGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|9507440|ref|NC_002122.1|:c64156-63464 Shigella sonnei plasmid P9 DNA, complete sequence
ATGACCGAAAATACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAGTCAGCCAGCATGGAGTCAGA
ATGATGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATCTCCTCCCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGTCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGTGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTCCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design