SecReT4
Protein ID: 9507514
T4SS name [ID]Tra_I [162]
Gene symboltraL
Locus tagColIb-P9_p075
StrainPlasmid ColIb-P9
Repliconplasmid ColIb-P9 [GenBank: NC_002122] [Browse all T4SS(s) in this replicon]
Location [Strand]64153..64500 [-]
Producthypothetical protein
Component typeTraL_I
UniProt IDQ9Z4A8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|9507514|ref|NP_052521.1| traL [Shigella sonnei]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYNL
 
Nucleotide Sequence: 348 bp     [Download]
>gi|9507440|ref|NC_002122.1|:c64500-64153 Shigella sonnei plasmid P9 DNA, complete sequence
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGCGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAACCTATGA
 Primer design