SecReT4
Protein ID: 9507612
T4SS name [ID]Tra_F [114]
Gene symbolX
Locus tagD742_p2045
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]49965..50474 [-]
Producthypothetical protein
Component typeOrf169_F
UniProt IDQ7AK76
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 169 a.a.     [Download]
>gi|9507612|ref|NP_052943.1| X [Shigella flexneri 2b]
MKKWMLAICLMFINGICEAADCFDLAGRDYKIDPDLLRAISWKESRYRVNAIGINPVTGYGSGLMQVDSQ
HFNELARYGIKPEHLTTDPCMNIYTGAYYLAIAFKKWGVSWEAVGAYNAGFRKTERQNQRRLAYASEVYR
IYTWIKSSKGIRVPTTKKSLSQINSVQKN
 
Nucleotide Sequence: 510 bp     [Download]
>gi|9507549|ref|NC_002134.1|:c50474-49965 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAAAAAATGGATGTTAGCAATCTGCCTGATGTTTATAAATGGGATCTGCGAAGCCGCCGATTGCTTTG
ATCTTGCAGGTCGGGATTACAAAATAGACCCGGATTTACTGAGAGCGATATCATGGAAAGAATCCCGTTA
CCGGGTTAATGCCATCGGTATTAATCCGGTAACGGGATATGGCAGCGGACTGATGCAGGTAGATTCCCAG
CATTTTAACGAACTGGCCCGCTATGGAATTAAGCCGGAACATCTGACAACAGATCCCTGTATGAACATTT
ATACCGGTGCTTATTATCTGGCAATAGCCTTTAAAAAATGGGGCGTCTCCTGGGAGGCCGTTGGTGCATA
CAATGCCGGATTCAGGAAGACCGAACGCCAGAACCAGAGACGTCTTGCCTACGCATCAGAGGTTTACCGG
ATTTATACCTGGATAAAGAGCAGTAAAGGCATCCGGGTTCCGACCACGAAGAAATCACTTTCCCAAATTA
ACAGTGTGCAGAAAAATTAA
 Primer design