SecReT4
Protein ID: 9507613
T4SS name [ID]Tra_F [114]
Gene symboltraM
Locus tagD742_p2066
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]50890..51273 [+]
Producthypothetical protein
Component typeTraM_F
UniProt IDP13973
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Tra_M [PF05261], Evalue: 3.6e-58, Aligned region: 1..127
Protein Sequence: 127 a.a.     [Download]
>gi|9507613|ref|NP_052944.1| traM [Shigella flexneri 2b]
MARVILYISNDVYDKVNAIVEQRRQEGARDKDISVSGTASMLLELGLRVYEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDEE
 
Nucleotide Sequence: 384 bp     [Download]
>gi|9507549|ref|NC_002134.1|:50890-51273 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGGCCAGAGTAATTTTGTATATCAGTAATGATGTCTATGATAAAGTAAATGCGATAGTTGAACAGCGTC
GTCAGGAGGGGGCAAGAGATAAAGATATAAGTGTTTCGGGAACAGCTTCAATGCTTCTTGAACTGGGGCT
TCGTGTATATGAGGCTCAGATGGAGCGTAAAGAGTCTGCGTTTAATCAGACAGAGTTTAATAAACTTCTT
CTTGAATGTGTTGTAAAAACACAGTCATCAGTAGCGAAAATTTTGGGTATTGAGTCTCTAAGTCCCCATG
TCTCCGGGAATCCAAAGTTTGAATATGCCAATATGGTTGAAGATATTCGTGAGAAGGTGTCATCTGAGAT
GGAACGATTTTTTCCAAAAAATGATGAGGAATAA
 Primer design