SecReT4
Protein ID: 9507615
T4SS name [ID]Tra_F [114]
Gene symboltraY
Locus tagD742_p2055
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]52275..52502 [+]
Productcomponent of oriT-specific nickase
Component typeTraY_F
UniProt IDQ7AK74
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 2.4e-21, Aligned region: 14..59
Protein Sequence: 75 a.a.     [Download]
>gi|9507615|ref|NP_052946.1| component of oriT-specific nickase [Shigella flexneri 2b]
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDS
IIKDL
 
Nucleotide Sequence: 228 bp     [Download]
>gi|9507549|ref|NC_002134.1|:52275-52502 Shigella flexneri 2b plasmid R100 DNA, complete sequence
TTGAGCAGAAATATAATAAGGCCTGCTCCGGGCAATAAAGTTTTACTGGTATTGGACGATGCTACTAATC
ACAAGCTCTTAGGTGCCCGGGAACGTAGTGGGAGAACAAAAACTAATGAGGTGCTAGTCAGGTTACGTGA
TCATCTGAACCGTTTTCCTGACTTTTATAATCTGGATGCAATAAAGGAGGGAGCAGAGGAAACTGATTCG
ATAATTAAAGATCTTTAG
 Primer design