SecReT4
Protein ID: 9507616
T4SS name [ID]Tra_F [114]
Gene symboltraA
Locus tagD742_p2078
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]52535..52894 [+]
Productprepropilin
Component typeTraA_F
UniProt IDQ7AK73
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 4.4e-55, Aligned region: 1..118
Protein Sequence: 119 a.a.     [Download]
>gi|9507616|ref|NP_052947.1| prepropilin [Shigella flexneri 2b]
MNTVLSVQGASAPVEKKSFFSKFTRLNMLRLVRAVIPVAVLMMLFPELAMAAGKGDLMAKGNDTVKATFG
KDSSIVKWVVLAEVLVGAVMYMMTKNVKFLVGFAIISVFIAVGMSVVGL
 
Nucleotide Sequence: 360 bp     [Download]
>gi|9507549|ref|NC_002134.1|:52535-52894 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAATACTGTTTTAAGTGTTCAGGGTGCTTCTGCGCCCGTTGAAAAGAAATCGTTTTTTTCTAAATTCA
CTCGTCTGAATATGCTTCGCCTGGTTCGTGCAGTGATCCCGGTTGCTGTTCTGATGATGTTGTTCCCTGA
GTTAGCTATGGCTGCTGGTAAAGGCGACCTGATGGCTAAAGGTAACGATACGGTTAAGGCGACCTTCGGT
AAGGACTCCAGTATCGTTAAATGGGTTGTTCTGGCTGAGGTGCTGGTCGGTGCGGTCATGTACATGATGA
CCAAAAACGTCAAGTTCCTGGTCGGCTTTGCCATCATCTCTGTATTTATTGCTGTGGGTATGAGCGTCGT
TGGCCTCTGA
 Primer design