SecReT4
Protein ID: 9507617
T4SS name [ID]Tra_F [114]
Gene symboltraL
Locus tagD742_p2067
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]52909..53220 [+]
Producthypothetical protein
Component typeTraL_F
UniProt IDQ9WTE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.8e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|9507617|ref|NP_052948.1| traL [Shigella flexneri 2b]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICVGWGITTSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|9507549|ref|NC_002134.1|:52909-53220 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTGTTGGCTGGGGTATCACAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design