SecReT4
Protein ID: 9507618
T4SS name [ID]Tra_F [114]
Gene symboltraE
Locus tagD742_p2074
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]53242..53808 [+]
Producthypothetical protein
Component typeTraE_F
UniProt IDQ9WTE0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.4e-69, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|9507618|ref|NP_052949.1| traE [Shigella flexneri 2b]
MEHGARLSTSRVMAIAFIFMSVLIVLSLSVNLIQGVNNYRLQNEQRTAVTPMGFNVPFAVSQNSADASYL
QQMALSFIALRLNVSPEIVDASHQALLQYIRPGAQNQMKVILAEEAKLIKKDNVNSAFFQTSVRVWPQYG
RVEIRGIRKTWIGNSEPFTDIKHYILILKRENGVTWLDNFGETDDEKK
 
Nucleotide Sequence: 567 bp     [Download]
>gi|9507549|ref|NC_002134.1|:53242-53808 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGGAACACGGTGCCCGTTTAAGTACCAGTCGTGTAATGGCCATCGCCTTTATATTTATGTCAGTGCTTA
TTGTTCTCAGCCTCTCTGTTAACCTCATTCAGGGGGTGAATAACTACCGTCTTCAGAATGAGCAACGCAC
TGCCGTGACCCCAATGGGATTTAATGTGCCCTTTGCCGTGTCACAGAACAGTGCCGATGCCTCTTATTTG
CAGCAGATGGCGCTGTCATTTATTGCCCTCCGTCTGAATGTCTCACCGGAAATCGTCGATGCTTCACATC
AGGCGCTTCTGCAATATATCCGCCCGGGTGCACAGAACCAGATGAAAGTTATTCTGGCTGAAGAAGCGAA
ACTCATTAAAAAAGATAACGTGAATTCTGCTTTTTTCCAGACCAGTGTCCGTGTCTGGCCTCAGTATGGT
CGTGTGGAAATCCGTGGAATTCGGAAAACATGGATTGGTAACTCCGAACCTTTTACTGATATCAAACATT
ACATCCTTATTCTGAAGCGGGAAAACGGGGTGACCTGGCTGGATAATTTCGGGGAAACAGACGATGAGAA
AAAATAA
 Primer design