SecReT4
Protein ID: 9507619
T4SS name [ID]Tra_F [114]
Gene symboltraK
Locus tagD742_p2068
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]53795..54523 [+]
Producthypothetical protein
Component typeTraK_F
UniProt IDQ46999
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 5.7e-69, Aligned region: 13..235
Protein Sequence: 242 a.a.     [Download]
>gi|9507619|ref|NP_052950.1| traK [Shigella flexneri 2b]
MRKNNTAIIFGGLFFSCSVMAANGTLAPTVVPMVNGGQASIAISNTSPNLFTVPGDRIIAVNSLDGALTN
NEQTASGGVVVATVNKKPFTFILETERGLNLSIQAVPREGAGRTIQLVSDLRGTGEEAGAWETSTPYESL
LVTISQAVRGGKLPAGWYQVPVTKETLQAPAGLSSVADSVWTGNHLKMVRFVVENKTLSALNIRESDFWQ
PGTRAVMFSQPASQLLAGARMDVYVIRDGEGN
 
Nucleotide Sequence: 729 bp     [Download]
>gi|9507549|ref|NC_002134.1|:53795-54523 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAGAAAAAATAATACGGCAATAATATTCGGCGGCCTGTTTTTTTCCTGCAGCGTGATGGCCGCAAACG
GTACGCTGGCCCCCACTGTGGTGCCAATGGTGAACGGTGGTCAGGCCAGTATTGCCATCAGCAATACCAG
CCCGAATCTGTTTACCGTTCCCGGTGACCGGATTATCGCCGTGAACAGTCTGGATGGTGCCCTGACCAAT
AATGAGCAGACCGCCTCCGGCGGTGTGGTGGTGGCCACCGTCAACAAAAAGCCCTTTACGTTCATTCTGG
AAACAGAGCGTGGTCTGAACCTTTCCATTCAGGCTGTTCCCCGTGAAGGCGCGGGGCGTACCATTCAGCT
GGTCAGTGACCTGCGCGGAACCGGAGAAGAAGCCGGAGCGTGGGAAACGTCCACGCCTTACGAATCCCTG
CTTGTGACCATCAGCCAGGCTGTCCGTGGCGGAAAATTACCTGCAGGCTGGTATCAGGTTCCTGTGACAA
AGGAAACCCTGCAGGCCCCGGCGGGGCTGTCTTCAGTGGCAGATTCCGTATGGACGGGGAATCACCTGAA
GATGGTCCGCTTTGTCGTGGAAAATAAAACGCTGTCTGCCCTGAATATCCGGGAAAGTGATTTCTGGCAG
CCGGGAACCCGTGCCGTGATGTTCAGCCAGCCTGCCAGCCAGTTACTGGCAGGTGCGCGCATGGATGTGT
ATGTCATCCGTGACGGGGAGGGCAACTGA
 Primer design