SecReT4
Protein ID: 9507620
T4SS name [ID]Tra_F [114]
Gene symboltraB
Locus tagD742_p2077
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]54523..55974 [+]
Producthypothetical protein
Component typeTraB_F
UniProt IDQ9WTD8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.1e-40, Aligned region: 213..409
CALCOCO1 [PF07888], Evalue: 4.8e-05, Aligned region: 68..121
Protein Sequence: 483 a.a.     [Download]
>gi|9507620|ref|NP_052951.1| traB [Shigella flexneri 2b]
MASINTIVKRKQYLWLGIVVVGTASAIGGALYLSDVDMSGNGETVAEQEPVPDMTGVVDTTFDDKVRQHA
TTEMQVTAAQMQKQYEEIRRELDVLNKQRGDDQRRIEKLGQDNAALAEQVKALGANPVTATGEPVPQMPA
PPPGPEGEPQPGNTPVSFPPQGSVAVPPPTAFYPGNGVTPPPQVTYQSVPVPNRIQRKVFTRNEGKQGPS
LPYIPSGSFAKAMLIEGADANASVTGNESTVPMQLRITGLVEMPNSKTYDATGCFVGLEAWGDVSSERAI
VRTRNISCLKDGKTIDMPIKGHVSFRGKNGIKGEVVMRNGKILGWAWGAGFVDGIGQGMERASQPAVGLG
ATAAYGAGDVLKMGIGGGASKAAQTLSDYYIKRAEQYHPVIPIGAGNEVTVVFQDGFQLKTVEEMALEQS
QSTAEEGNPESPVPNPPSAESHLNGFNTDQMLKQLGNLNPQQFMSGDKNPLGGDAGKEGGNGG
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|9507549|ref|NC_002134.1|:54523-55974 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGGCCAGTATCAATACCATTGTGAAACGCAAGCAGTACCTGTGGCTGGGGATTGTGGTTGTCGGTACAG
CCTCCGCGATTGGTGGGGCACTGTATCTGTCTGATGTGGACATGTCCGGTAACGGTGAAACCGTGGCTGA
ACAGGAGCCTGTGCCGGATATGACCGGTGTGGTGGATACGACCTTTGATGACAAGGTGCGTCAGCATGCC
ACCACAGAGATGCAGGTGACGGCAGCGCAGATGCAGAAGCAGTATGAGGAAATCCGTCGTGAGCTGGATG
TTCTGAACAAACAGCGCGGTGATGACCAGCGTCGTATTGAAAAGCTGGGACAGGACAATGCCGCCCTGGC
AGAGCAGGTAAAAGCCCTGGGTGCTAATCCCGTCACGGCGACCGGTGAGCCTGTACCGCAGATGCCTGCC
CCACCGCCCGGCCCGGAAGGCGAACCACAGCCAGGAAACACCCCCGTATCCTTCCCGCCGCAGGGCAGCG
TTGCTGTTCCACCGCCGACGGCGTTTTATCCCGGGAATGGTGTCACGCCACCACCACAGGTGACGTACCA
GTCTGTGCCGGTGCCTAACCGGATACAGCGTAAGGTGTTTACCCGTAATGAGGGAAAACAGGGACCATCG
CTGCCGTACATTCCGTCAGGAAGTTTTGCGAAAGCCATGCTGATTGAAGGGGCGGATGCCAATGCCTCAG
TCACCGGTAATGAATCCACGGTGCCGATGCAGTTGCGTATCACCGGCCTGGTGGAAATGCCGAACAGCAA
GACGTATGACGCAACGGGATGTTTTGTGGGGCTGGAAGCCTGGGGGGATGTGTCCAGTGAACGTGCCATT
GTACGCACCCGCAATATCAGTTGCCTGAAGGACGGCAAAACTATTGATATGCCGATTAAGGGGCATGTCA
GCTTCCGGGGTAAAAACGGTATCAAGGGCGAAGTGGTGATGCGTAACGGCAAAATCCTCGGCTGGGCATG
GGGCGCGGGATTTGTTGACGGTATCGGTCAGGGAATGGAGCGCGCCTCCCAACCGGCTGTCGGGCTGGGT
GCCACAGCCGCTTACGGGGCTGGTGATGTCCTGAAAATGGGTATCGGTGGCGGCGCATCGAAAGCCGCAC
AGACGCTCAGTGACTACTACATCAAACGTGCCGAACAGTATCACCCGGTGATACCGATTGGTGCGGGCAA
CGAAGTGACCGTGGTGTTCCAGGACGGCTTCCAGCTGAAAACCGTGGAGGAAATGGCACTGGAGCAGTCA
CAGAGTACAGCGGAAGAGGGTAACCCGGAAAGCCCGGTGCCGAATCCTCCCTCGGCAGAAAGCCACCTGA
ACGGTTTTAACACCGACCAGATGCTGAAACAGCTGGGCAATCTGAATCCGCAGCAGTTTATGTCCGGAGA
CAAGAACCCGCTGGGCGGGGATGCCGGCAAGGAGGGCGGAAATGGCGGGTGA
 Primer design