SecReT4
Protein ID: 9507623
T4SS name [ID]Tra_F [114]
Gene symboltraV
Locus tagD742_p2058
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]56834..57349 [+]
Producthypothetical protein
Component typeTraV_F
UniProt IDQ7AK72
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.1e-40, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|9507623|ref|NP_052954.1| traV [Shigella flexneri 2b]
MKQISLFIPLLGTLLLSGCAGTNTEFECNATTSDTCMTMEQANEKAKKLEQSSEAKPVAASLPRLAEGNF
RTMPVQTVTATTPSGSRPAVTAHPEQKLLAPRPLFTAAREVKTVVPVSSVTPVTPPRPLRTGEQTAALWI
APYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|9507549|ref|NC_002134.1|:56834-57349 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAAACAGATTTCTTTATTTATTCCTCTGCTGGGAACCTTATTACTTTCCGGCTGCGCAGGAACAAATA
CGGAATTTGAGTGTAACGCCACCACATCCGATACCTGTATGACGATGGAGCAGGCCAATGAGAAGGCCAA
AAAACTGGAGCAGTCCTCAGAAGCAAAGCCGGTTGCGGCATCACTGCCGCGCCTGGCTGAAGGGAACTTC
CGGACAATGCCGGTGCAGACCGTCACCGCGACCACTCCGTCCGGCAGCAGACCTGCGGTGACAGCACATC
CGGAGCAGAAACTGCTGGCACCACGCCCGCTGTTTACCGCTGCCCGGGAAGTGAAAACGGTTGTTCCGGT
CAGTTCAGTTACGCCGGTAACACCTCCTCGTCCGCTAAGAACGGGTGAGCAGACGGCAGCATTATGGATA
GCGCCTTATATTGATAACCAGGATGTTTATCATCAGCCATCCAGCGTGTTTTTTGTTATTAAACCGTCTG
CGTGGGGAAAACCACGTATTAATTAA
 Primer design