SecReT4
Protein ID: 9507629
T4SS name [ID]Tra_F [114]
Gene symboltraC
Locus tagD742_p2076
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]59376..62006 [+]
Producthypothetical protein
Component typeTraC_F
UniProt IDQ9WTC9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.2e-58, Aligned region: 38..278
AAA_10 [PF12846], Evalue: 4.1e-43, Aligned region: 480..773
DUF87 [PF01935], Evalue: 3.2e-05, Aligned region: 483..670
TrwB_AAD_bind [PF10412], Evalue: 7.4e-05, Aligned region: 480..518
Protein Sequence: 876 a.a.     [Download]
>gi|9507629|ref|NP_052960.1| traC [Shigella flexneri 2b]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|9507549|ref|NC_002134.1|:59376-62006 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAGTAATAACCCACTTGAGGCCGTCACTCAGGCGGTTAACTCCCTCGTCACAGCACTGAAACTGCCTG
ACGAATCCGCAAAGGCCAATGAAGTTCTGGGCGAAATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTA
CCGTGATTACAACCAGGAATCCGGTCTGTTCATGAATGACACCACGATGGGCTTTATGCTGGAAGCCATT
CCCATCAATGGGGCGAATAAGTCCATTGTGGAGGCACTCGATCACATGCTGCGCACCAAACTGCCGCGCG
GTATTCCGTTGTGTATCCATCTGATGTCCAGTCAGCTGGTTGGTGACAGGATTGAGTACGGGCTGCGTGA
GTTCTCCTGGTCAGGTGAACAGGCTGAACGGTTTAACGCCATTACCCGGGCCTATTATATGAAAGCGGCA
GCGACACAGTTTCCGCTGCCGGAGGGGATGAATCTGCCCCTGACCCTGCGCCATTACCGGGTATTTATCT
CGTACTGTTCTCCCTCGAAGAAAAAAAGCCGGGCTGACATTCTGGAAATGGAAAACCTGGTGAAAATCAT
CCGGGCGTCGTTACAGGGGGCCAGTATCGCCACACAGACGGTGGATGCACAGGCCTTTATCGATATTGTC
GGGGAGATGATTAACCATAACCCGGACTCCCTGTACCCGAAAAGACGTCAGCTGGACCCGTATTCTGATC
TGAATTATCAGTGTGTGGAGGACAGTTTTGACCTGAATGTCCGGGCTGATTACCTGACGCTGGGCCTGCG
TGAGAACGGCAGGAACAGCACGGCCCGTATCCTGAATTTCCATCTGGCCCGTAACCCGGAAATCGCCTTC
CTGTGGAATATGGCCGACAACTACAGCAACCTGCTGAACCCGGAACTGTCCATCTCCTGTCCGTTCATCC
TGACGCTGACTCTGGTGGTGGAAGACCAGGTGAAAACCCACAGCGAAGCCAACCTGAAGTACATGGACCT
GGAGAAAAAGTCGAAGACCTCCTATGCCAAATGGTTTCCGTCCGTGGAGAAAGAGGCGAAGGAGTGGGGG
GAACTGCGTCAGCGTCTGGGCTCCGGTCAGTCTTCTGTCGTGTCCTACTTCCTCAACATCACAGCATTCT
GCAAGGACAACAATGAAACGGCGCTGGAAGTGGAGCAGGACATCCTGAACAGCTTCCGTAAAAACGGTTT
TGAGCTGATTTCACCGCGCTTTAACCACATGCGCAATTTCCTGACCTGTCTGCCCTTTATGGCCGGGAAA
GGGTTGTTTAAACAGCTGAAAGAGGCCGGAGTGGTTCAGCGCGCAGAGAGCTTTAATGTTGCCAACCTGA
TGCCGTTAGTGGCGGATAACCCCCTGACACCGGCAGGTCTGCTGGCACCCACCTACCGTAACCAGCTGGC
GTTTATCGATATTTTCTTCCGGGGGATGAATAACACCAACTACAACATGGCGGTCTGTGGCACCTCCGGG
GCCGGTAAAACCGGGCTGATACAGCCACTTATCCGCAGCGTGCTGGACTCCGGGGGCTTTGCCGTGGTGT
TCGACATGGGGGATGGCTACAAGTCCCTGTGTGAGAACATGGGTGGCGTATATCTGGACGGTGAAACCCT
GCGTTTTAACCCGTTTGCGAACATCACCGATATTGACCAGTCAGCGGAGCGTGTCCGTGACCAGTTGTCA
GTGATGGCCAGCCCCAACGGTAACCTGGATGAAGTGCATGAAGGTCTGCTGCTGCAGGCGGTCAGGGCCT
CCTGGCTGGCCAAAGAGAACAGGGCACGTATTGATGACGTGGTGGATTTCCTGAAAAACGCCAGTGACAG
CGAGCAGTATGCCGGGTCACCGACCATCCGCAGCCGTCTGGACGAAATGATTGTGCTGCTTGACCAGTAC
ACTGCCAACGGCACTTACGGCCAGTATTTTAACTCCGATGAGCCGTCCCTGCGGGATGATGCGAAAATGG
TGGTGCTGGAGCTGGGCGGACTGGAAGACCGTCCGTCACTGCTGGTTGCGGTGATGTTCTCCCTGATTAT
CTACATCGAGAACAGGATGTACCGCACGCCGCGTAACCTCAAGAAACTGAACGTTATTGATGAAGGCTGG
CGTCTGCTGGACTTCAAAAATCGCAAGGTCGGTGAGTTTATTGAGAAAGGTTACCGTACCGCCCGCCGTC
ATACCGGTGCCTATATCACCATCACACAGAACATCGTCGACTTTGACTCTGACAAGGCCTCCAGTGCGGC
CCGTGCGGCATGGGGTAACTCCTCCTACAAAATTATCCTCAAACAGAGTGCGAAGGAGTTCGCAAAATAC
AACCAGCTGTATCCGGACCAGTTCCAGCCACTGCAGCGCGACATGATTGGTAAGTTTGGTGCGGCCAAAG
ACCAGTGGTTCAGTTCCTTCCTGCTGCAGGTGGAAAACCATTCCTCCTGGCACCGCCTGTTTGTGGACCC
GTTAAGCCGCGCCATGTACAGCTCTGACGGCCCGGATTTTGAGTTTGTGCAGCAGAAACGTAAAGAGGGG
CTGAGTATTCATGAGGCGGTGTGGCAGCTGGCGTGGAAGAAGTCAGGGCCGGAGATGGCTTCGCTGGAAG
CCTGGCTGGAAGAACATGAGAAATACAGGAGTGTTGCATGA
 Primer design