SecReT4
Protein ID: 9507632
T4SS name [ID]Tra_F [114]
Gene symboltraU
Locus tagD742_p2059
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]63015..64007 [+]
Producthypothetical protein
Component typeTraU_F
UniProt IDQ9WTC6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.4e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|9507632|ref|NP_052963.1| traU [Shigella flexneri 2b]
MKRSLWLLMLFLLAGHVPAASADSACEGRFVNPITDICWSCIFPLSLGSIKVSQGKVPDTANPSMPIQIC
PAPPPLFRRIGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKDEKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNMPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|9507549|ref|NC_002134.1|:63015-64007 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAAGCGAAGCCTGTGGCTGCTGATGTTATTCCTTCTCGCCGGTCATGTCCCTGCGGCATCTGCGGATT
CTGCCTGTGAGGGGCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTATTTTCCCGCTCTCGCT
GGGCAGTATCAAAGTCAGTCAGGGTAAGGTCCCCGACACGGCGAACCCGTCGATGCCCATTCAGATTTGT
CCGGCACCGCCGCCGCTGTTCAGGCGTATCGGGCTGGCCATTGGTTACTGGGAGCCGATGGCGCTGACGG
ACGTCACCCGGTCACCGGGATGCATGGTGAACCTGGGCTTCAGCCTGCCGGCTTTTGGTAAAACGGCACA
GGGAACGGCGAAAAAGGATGAGAAGCAGGTGAACGGGGCGTTCTATCACGTTCACTGGTACAAATACCCG
CTGACGTACTGGCTTAACATCATCACATCGCTGGGCTGTCTGGAAGGTGGTGACCTGGATATCGCTTATC
TTTCTGAAATTGACCCCACCTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCTGTCATCTT
TGCCAATCCGATAGCACAGGGGGCCTGTGCAGCAGATGCCATTGCCAGCGCCTTTAATATGCCTCTCGAT
GTTCTGTTCTGGTGTGCCGGTTCGCAGGGCAGTATGTACCCGTTCAATGGCTGGGTGAGTAATGAGTCCA
GTCCGTTGCAGTCCTCCCTGCTGGTCAGTGAACGCATGGCGTTCAAACTACACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCCGTCTGTAATGAATATCCGTCCCCAATCCTGCCTAAAGAACGCTGG
CGTTATCAGATGGTGAATATGTATCCGGACAGCGGACAGTGCCATCCGTTCGGGCGCAGTGTGATGCGCT
GGGAGACGGGAAAAAATCCGCCCAACACAAAGAAAAACTTCGGCTACCTGATGTGGCGTAAACGTAACTG
TGTATTCCTGTAA
 Primer design