SecReT4
Protein ID: 9507634
T4SS name [ID]Tra_F [114]
Gene symboltrbC
Locus tagD742_p2051
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]64351..64989 [+]
Producthypothetical protein
Component typeTrbC_F
UniProt IDQ9WTC4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 4.7e-28, Aligned region: 93..191
Protein Sequence: 212 a.a.     [Download]
>gi|9507634|ref|NP_052965.1| trbC [Shigella flexneri 2b]
MNRKIFALFALTAGMHLAVHASENVNTTENRQFLKQQENLSRQLREKPDHQLKAWAEKQVLENPLQRSDN
HFLDELVRKQQASQDGKPRQGALYFVSFSIPEEGLKRMLGETRHYGIPATLRGMVNNDLKTTAEAVLSLV
KDGATDGVQIDPTLFSQYGIRSVPALVVFCSQGYDIIRGNLRVGQALEKVAATGDCRQVAHDLLAGKGDS
GK
 
Nucleotide Sequence: 639 bp     [Download]
>gi|9507549|ref|NC_002134.1|:64351-64989 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGAACCGGAAAATATTTGCACTTTTTGCTCTGACAGCAGGGATGCATCTTGCTGTTCATGCTTCAGAAA
ATGTGAACACAACTGAAAACCGCCAGTTCCTGAAGCAGCAGGAAAATTTAAGCAGACAACTGCGAGAGAA
ACCTGACCATCAGCTGAAAGCCTGGGCGGAGAAACAGGTGCTGGAAAACCCCCTTCAGCGTTCAGATAAC
CATTTTCTGGATGAGCTGGTTCGTAAACAGCAGGCTTCGCAGGACGGGAAACCCCGGCAGGGTGCCCTGT
ATTTTGTGTCGTTTTCCATTCCCGAAGAGGGGCTGAAACGGATGCTGGGCGAAACCCGGCACTACGGTAT
ACCCGCCACACTGCGGGGCATGGTGAACAATGACCTGAAGACCACCGCTGAAGCCGTGCTGTCCCTGGTG
AAAGACGGCGCGACTGATGGTGTTCAGATCGACCCGACGCTGTTTTCACAGTACGGCATTCGCAGTGTAC
CGGCACTGGTGGTGTTCTGCAGTCAGGGATACGACATCATCCGGGGAAACCTGCGGGTCGGCCAGGCGCT
GGAGAAAGTGGCCGCCACGGGTGACTGCCGGCAGGTGGCTCATGATTTACTGGCAGGGAAAGGAGATTCC
GGGAAATGA
 Primer design