SecReT4
Protein ID: 9507638
T4SS name [ID]Tra_F [114]
Gene symboltraF
Locus tagD742_p2073
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]67095..67856 [+]
Producthypothetical protein
Component typeTraF_F
UniProt IDQ9WTC0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 6.4e-79, Aligned region: 29..243
Protein Sequence: 253 a.a.     [Download]
>gi|9507638|ref|NP_052969.1| traF [Shigella flexneri 2b]
MMKGMKMNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKR
ALYEAILYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQR
QAIAKLAEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVK
YFPAMMLVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 762 bp     [Download]
>gi|9507549|ref|NC_002134.1|:67095-67856 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGATGAAAGGAATGAAGATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGT
CAGGGAAAGATGCAGGCTGGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGT
ACCTGCAGCCCCCCGTCAGGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGG
GCGCTGTACGAAGCCATTCTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCCGGCTGCAGAATTACT
GGACTCAGCAGGCCGGGCTTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACATCCCGAACTGGACTA
TAACCTGCAGTACAGCCATTACAACGGCACGGTACGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGA
CAGGCCATTGCGAAACTGGCTGAACACTACGGCATCATGTTCTTTTACCGGGGGCAGGACCCCATCGACG
GGCAACTGGCGCAGGTCATTAATGGCTTCAGGGATACCTATGGTCTGAGTGTTATTCCCGTTTCCGTGGA
TGGCGTGATTAATCCGCTGTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGTGTGAAA
TATTTCCCGGCCATGATGCTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTT
CACAGGACGACCTGGCAAAACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTTTTAA
 Primer design