SecReT4
Protein ID: 9507640
T4SS name [ID]Tra_F [114]
Gene symboltraQ
Locus tagD742_p2063
StrainPlasmid R100
Repliconplasmid R100 [GenBank: NC_002134] [Browse all T4SS(s) in this replicon]
Location [Strand]68333..68617 [+]
Productpossible cleavage protein of preproplin
Component typeTraQ_F
UniProt IDQ7AK65
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 5.7e-50, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|9507640|ref|NP_052971.1| possible cleavage protein of preproplin [Shigella flexneri 2b]
MISKYRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|9507549|ref|NC_002134.1|:68333-68617 Shigella flexneri 2b plasmid R100 DNA, complete sequence
ATGATAAGTAAATACAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design